Neuerwerbungen



nach Bibliotheken geordnet

Buchcover

„Golden flackert die Flamme!“ das Reichsbanner Schwarz-Rot-Gold in Baden und Württemberg 1924 bis 1933

Böhles, Marcel,,

Metropol, 2024

ISBN 978-3-86331-725-6 | 2024-02-23 | 54 Geschichte

Hauptbibliothek: Freihand, 600/NZ 72110 B671 [verfügbar]

Buchcover

#stoppt Belästigung : Wahrnehmung & Akzeptanz sexualisierter Übergriffigkeit unter Berücksichtigung des Einflusses öffentlichen Ankreidens von Catcalling & sozialen Normen

Kreft, Bianca

Masterarbeit, Universität Innsbruck, 2021 - Volltext: BibSearch

2024-02-21 | 05 Psychologie


Beschreibung: ger: Straßenbelästigung und Catcalling werden aufgrund von kultureller Verankerung trivialisiert und vermeintlich als Komplimente kategorisiert. Vor diesem Hintergrund hat die Chalk Back Bewegung das ‚Ankreiden‘ von Catcalls initiiert, um Aufmerksamkeit für diese Art der sexualisierten Übergriffigkeit zu generieren. Mit Hilfe lokaler Präsenz und der salienten Norm #stoppt Belästigung versuchen Catcalls of Communities ein Umdenken zu erzeugen. Es wird angenommen, dass das Zeigen einfacher Zitate versus Kreidebilder im Stil der Catcalls of Communities bei Männern unterschiedliche Wirkung zeigen. Es werden sowohl eine Wirkung auf die direkte Wahrnehmung von Catcalling und eine Einstellungsänderung zur Akzeptanz von Vergewaltigungsmythen erwartet. Des Weiteren werden Einflüsse von traditionellen Geschlechternormen, einer feministischen Grundhaltung, das Vorwissen über Catcalling sowie das Alter auf die Wahrnehmung und Akzeptanz von sexualisierter Übergriffigkeit angenommen. In einem Fragebogen im between-subject Treatmentdesign werden die Teilnehmenden (N = 996; KG: n = 519; EG: n = 477) aufgefordert, Kommentare in ihrer Wahrnehmung als Kompliment und Catcall zu bewerten. Die Ergebnisse zeigen, dass das Zeigen der Kreidebilder eine Reduktion der Vergewaltigungsmythenakzeptanz bei Männern, nicht aber bei Frauen, erzeugt. Auf die Wahrnehmung von sexualisierter Übergriffigkeit konnte kein Interaktionseffekt, aber ein Haupteffekt des Geschlechts gefunden werden. Die untersuchten Prädiktoren zeigen sich alle signifikant. Die Orientierung an Geschlechternormen zeigt sich als aussagekräftigster Prädiktor. Ein Einfluss von traditionellen Normen auf die Wahrnehmung und Einstellung gegenüber sexualisierter Gewalt ist ersichtlich. Die Dringlichkeit für das Thema zu sensibilisieren, Geschlechternormen zu hinterfragen und eine Neunormierung der Geschlechterverhältnisse anzustreben, um weiter die Wahrnehmung und Inakzeptanz sexualisierte Übergriffe zu schärfen, wird deutlich und ist Ziel weiterer Forschung.

Hauptbibliothek: Magazin HB, DG67774 [verfügbar]

Buchcover

1 × 1 der Personalver­rechnung 2024

Portele, Karl

Linde Verlag GesmbH, 2024

ISBN 978-3-7073-4841-5 | 2024-02-29 | 10 Wirtschafts- und Sozialwissenschaften allgemein

e-Medien: https://www.lindedigital.at/plink/fb-1x1personal2024

Buchcover

10 Jahre EuErbVO Rück- und Ausblick zur EU-Erbrechtsverordnung

Düsseldorf-Graz-Symposium zum IZVR Düsseldorf; Online 2022 2.

Verlag Österreich, 2023

ISBN 978-3-7046-9262-7 | 2024-02-14 | 08 Recht


Beschreibung: Die Beiträge dieses Werks fußen auf Vorträgen, die beim 2. Düsseldorf-Graz-Symposium zum IZVR im September 2022 gehalten wurden. Im Tagungsband versammeln sich österreichische und deutsche Expertinnen und Experten aus Wissenschaft und Praxis, deren Abhandlungen die einzelnen Teile der EuErbVO nahezu vollständig abdecken. Dabei werden neben den systematisch orientierten Blöcken wie internationale Zuständigkeit, Rechtswahl, Anerkennung und Vollstreckung und dem ENZ auch die Einordnung der EuErbVO in das Gefüge des EuZVR, der gewöhnliche Aufenthalt, der Zusammenprall der EuErbVO mit mitgliedstaatlichen Prinzipien sowie Probleme im Verhältnis zu Drittstaaten in den Fokus gestellt. Die Autorinnen und Autoren behandeln ihre Abschnitte zwar einerseits vor dem Hintergrund ihrer nationalen Verfahrensrechte und Durchführungsgesetze, andererseits aber auch mit Blick auf die andere Rechtsordnung und leisten so einen Beitrag zur Entwicklung eines grenzüberschreitenden Diskurses im Europäischen Zivilverfahrensrecht. (https://www.buchhandel.de)

e-Medien: https://doi.org/10.33196/9783704692627

Buchcover

50 Jahre nach 50 Jahre Bauhaus = 50 years after 50 years of the bauhaus

Spector Books OHG, 2022

ISBN 978-3-95905-677-9 | 2024-02-14 | 42 Architektur


Beschreibung: Am 4. Mai 1968, wenige Stunden nachdem in Paris die Proteste aufgebrachter Studierender zur Räumung der Universität Sorbonne geführt hatten, wurde im Württembergischen Kunstverein die Ausstellung 50 Jahre Bauhaus eröffnet. Die von Herbert Bayer, Ludwig Grote, Hans Maria Wingler und dem damaligen Kunstvereinsdirektor Dieter Honisch konzipierte Schau gilt bis heute als wirkungsmächtigste Ausstellung des Bauhaus nach dem Zweiten Weltkrieg. 50 Jahre nach der Eröffnung von 50 Jahre Bauhaus unternahm der Württembergische Kunstverein eine kritische Relektüre der 1968er-Ausstellung. Dabei wurden insbesondere die ambivalenten Beziehungen zwischen einer Reihe der prominenten Bauhäusler·innen und dem Nationalsozialismus sowie zwischen den künstlerischen Avantgarden und dem industriell-militärischen Komplex in den Blick genommen. Entgegen der historisierenden und auf Westdeutschland und die USA reduzierten Rezeption des Bauhaus, die die 1968er-Ausstellung leistete, reflektiert die Publikation 50 Jahre nach 50 Jahre Bauhaus die berühmte Schule im Kontext künstlerischer Bewegungen wie dem Mouvement International pour un Bauhaus Imaginiste oder der Internationale Situationniste. Hans D. Christ, geb. 1963 in Dortmund, und Iris Dressler, geb. 1966 in Neuss, leiten seit 2005 den Württembergischen Kunstverein in Stuttgart.

Bibliothekszentrum West: Freihand, 800/ZH 4740 C554 [verfügbar]

Buchcover

50 Klassiker Skulpturen von der Antike bis zum 19. Jahrhundert

Johannsen, Rolf H.

Gerstenberg, 2005

ISBN 978-3-8067-2536-0 | 2024-02-08 | 45 Kunst

Hauptbibliothek: Magazin HB, 742791 [verfügbar]

Buchcover

7 Geheimnisse der Beichte

Flynn, Vinny.

Damaris Verlag, 2023

ISBN 978-3-9519757-1-9 | 2024-02-13 | 06 Religion, Theologie


Beschreibung: „Ich will zur Kommunion gehen, also muss ich vorher beichten gehen.“ Kommt dir das bekannt vor? Für viele Katholiken ist die Beichte nur ein Mittel zum Zweck. Doch sie ist viel mehr als nur eine Reinigung. Sie ist eine Begegnung mit Jesus: Er erwartet uns dort, und wir können zu ihm kommen, wie wir sind. In „7 Geheimnisse der Beichte“ erforscht der Autor Vinny Flynn die „verborgenen“ Wahrheiten dieser Begegnung mit Jesus. Er enthüllt zentrale Aspekte dieses Sakraments, die vielen Menschen einen neuen Zugang zur Beichte ermöglichen und sie einladen, sich auf einen wunderbaren Weg hin zu Heilung und Heiligkeit zu begeben. Wenn du dich auf die Beichte noch nicht so sehr freust wie auf die Kommunion, dann ist das ein Buch für dich. Es wird dein Leben verändern. (https://www.buchhandel.de)

Fachbibliothek Theologie: Magazin, N-20191 [verfügbar]

Buchcover

A field guide to managing diversity, equality and inclusion in organisations

Edward Elgar Publishing, 2023

ISBN 978-1-03-532742-3 | 2024-02-12 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: MCI-III, Weiherburgg. 8, 368-Fiel [verfügbar]

Buchcover

ABGB Taschenkommentar mit EheG, EPG, KSchG, ASVG, EKHG und IPRG

Neumayr, Matthias

LexisNexis, 2024

ISBN 978-3-7007-8314-5 | 2024-02-12 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Abschied von den Boomern

Bude, Heinz

Hanser, 2024

ISBN 978-3-446-27986-5 | 2024-02-08 | 11 Soziologie und Kulturwissenschaften


Beschreibung: Bye, bye, Boomer! Das Portrait einer Generation und ihrer inneren Widersprüche von Heinz Bude Die Boomer nehmen Abschied. Wer zwischen 1955 und 1970 in der Zeit der geburtenstarken Jahrgänge zur Welt gekommen ist, hat den Ruhestand erreicht oder zählt zu den Älteren, die nach und nach ihre Posten freimachen. Die Boomer verbindet das Gefühl, dass es zu viele von ihnen gibt, das spürten sie schon in überfüllten Klassenzimmern und später auf dem Arbeitsmarkt. Daraus resultierte eine Haltung der Skepsis, und die Erfahrung von AIDS und Tschernobyl hat sie in einer entscheidenden Phase ihrer Biografie gelehrt, dass nichts gesichert und gar nichts garantiert ist. Heinz Bude, ein früher Boomer, beschreibt, wie sich mit dieser Generation auch ein Lebensgefühl verabschiedet, das unsere Gesellschaft über Jahrzehnte geprägt hat. (https://www.buchhandel.de)

Hauptbibliothek: Freihand, 600/MS 2600 B927 [verfügbar]

Buchcover

Abwägung Voraussetzungen und Grenzen einer Metapher für rationales Entscheiden

Brill Mentis, 2022

ISBN 978-3-95743-253-7 | 2024-02-21 | 04 Philosophie


Beschreibung: Das Konzept der Abwägung wird in der praktischen Philosophie ebenso ubiquitär verwendet wie in den Wirtschaftswissenschaften und im Recht. Es ist jedoch voraussetzungsvoller und umstrittener als zumeist angenommen. „Abwägung“ bezeichnet einen Vorgang praktischen Überlegens, in den mehrere Aspekte in vergleichender Weise eingehen. Die Skepsis gegen das Konzept gründet darin, dass sich die Metapher nicht auf beliebige Gegenstände anwenden lässt. Insbesondere müssen die Wertzuschreibungen, die das Gewicht der Gegenstände bestimmen, in ihren normativen Grundlagen widerspruchsfrei sein und sie müssen ähnlich wie die Gewichtskräfte, mit denen Körper auf die Schalen einer Balkenwaage einwirken, eine gewisse Kontextinvarianz aufweisen. Das setzt Unabhängigkeitsannahmen voraus, deren Gültigkeit im Falle normativer Bewertungen nicht trivial ist. Der Band dient dem Zweck, diese Zusammenhänge durchsichtiger zu machen. Er entstand auf der Basis einer mehrjährigen Zusammenarbeit von Autor:innen aus den Fächern Philosophie, Jurisprudenz und Ökonomie. (https://www.buchhandel.de)

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Achtsam sprechen - kraftvoll schweigen für eine neue Gesprächskultur

Grün, Anselm,,

Vier-Türme-Verlag, 2019

ISBN 978-3-89680-820-2 | 2024-02-01 | 05 Psychologie

Hauptbibliothek: Magazin HB, 742771 [verfügbar]

Buchcover

Achtsame KI Zitate und Betrachtungen über Künstliche Intelligenz

Durmus, Murat.

Amazon Fulfillment, 2023

2024-02-12 | 02 Publizistik und Kommunikation

Fachbibliothek Theologie: Freihand, ITR 25-010 DURM [verfügbar]

Buchcover

Active assisted living

Kaiser, Peter

Hüthig, 2023

ISBN 978-3-8101-0541-7 | 2024-02-14 | 42 Architektur

Bibliothekszentrum West: Freihand, 800/ZH 3045 K13 [verfügbar]

Buchcover

Advanced introduction to advertising

Pelsmacker, Patrick de

Edward Elgar Publishing, 2022

ISBN 978-1-80220-090-4 | 2024-02-27 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 484-Pels [verfügbar]

Buchcover

Advanced introduction to business and human rights

Muchlinski, Peter T.

Edward Elgar Publishing, 2022

ISBN 978-1-78990-129-0 | 2024-02-27 | 10 Wirtschafts- und Sozialwissenschaften allgemein


Beschreibung: Elgar Advanced Introductions are stimulating and thoughtful introductions to major fields in the social sciences, business and law, expertly written by the world's leading scholars. Designed to be accessible yet rigorous, they offer concise and lucid surveys of the substantive and policy issues associated with discrete subject areas.Focusing on the adoption of the UN Guiding Principles on Business and Human Rights (UNGPs) in 2011, this timely book charts the field of business and human rights, finding that corporate responsibility to respect human rights is gradually evolving into a binding legal duty in both national and international law. Following the structure of the UNGPs, Peter T. Muchlinski also covers the state duty to protect against business violations of human rights, the corporate responsibility to respect human rights and access to remedies for corporate violations of human rights. Key Features: A detailed, critical, appraisal of the UNGPs in their historical, legal and political contexts. Coverage of developments in national law and policy to further the state's duty to protect against business violations of human rights. An interdisciplinary perspective drawing on history, law, business ethics, politics, and ideas of corporate governance with a view to introducing the field to readers with diverse specialist backgrounds. Coverage of new directions for business and human rights including calls for new mandatory corporate liability laws, a legally binding international treaty and new multi stakeholder initiatives for developing business and human rights standards. This Advanced Introduction will be a key guide for students and researchers in the fields of business and human rights, international law and business ethics, as well as lawyers and business managers who need an accessible primer to business and human rights.--

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 138-Much [verfügbar]

Buchcover

Advanced introduction to marketing strategy

Day, George S.

Edward Elgar Publishing, 2022

ISBN 978-1-80037-790-5 | 2024-02-27 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 471-Day [verfügbar]

Buchcover

Advanced introduction to pricing strategy and analytics

Rao, Vithala R.

Edward Elgar Publishing, 2023

ISBN 978-1-78811-007-5 | 2024-02-27 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 482-Rao [verfügbar]

Buchcover

Advanced introduction to scenario planning

Schoemaker, Paul J.

Edward Elgar Publishing, 2022

ISBN 978-1-80037-679-3 | 2024-02-27 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 314-Scho [verfügbar]

Buchcover

Adventurous learning a pedagogy for a changing world

Beames, Simon

Routledge Taylor & Francis Group, 2016

ISBN 978-1-315-73648-8 | 2024-02-27 | 07 Pädagogik


Beschreibung: Introduction -- Meanings of adventure -- Socio-cultural backdrop -- Adventure education, rationalization and commodification -- Authenticity -- Agency and responsibility -- Uncertainty -- Challenge through mastery -- Adventurous learning: weaving the strands together.

e-Medien: https://doi.org/10.4324/9781315736488

Buchcover

After the fall the legacy of fascism in Rome's architectural and urban history

Marcello, Flavia.

Bloomsbury Visual Arts, 2024

ISBN 978-1-350-12058-7 | 2024-02-14 | 42 Architektur

Bibliothekszentrum West: Freihand, 800/ZH 4746 M314 [verfügbar]

Buchcover

AGB-Klauseln in Bauverträgen einschließlich Architekten-, Ingenieur- und Bauträgerverträge

CHBeck, 2024

ISBN 978-3-406-80436-6 | 2024-02-19 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Agile innovation sprint Innovation im Unternehmen erlebbar machen

Kuhfuß, Andrea

Carl Hanser Verlag, 2024

ISBN 978-3-446-47851-0 | 2024-02-21 | 58 Fachlich nicht erfasste Objekte

e-Medien: https://doi.org/10.3139/9783446478510

Buchcover

Agrarmarketing Anforderungen an eine qualitätsorientierte Vermarktung von Agrargütern

Harth, Michael

Verlag Eugen Ulmer, 2022

ISBN 978-3-8252-5730-9 | 2024-02-26 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 471-Hart [verfügbar]

Buchcover

Algerische Skizzen

Bourdieu, Pierre

Suhrkamp, 2023

ISBN 978-3-518-30035-0 | 2024-01-29 | 11 Soziologie und Kulturwissenschaften

Hauptbibliothek: Freihand, 600/MQ 3070 A39.2023 [verfügbar]

Buchcover

Alles über Sex mach Schluss mit Mythen, Tabus und Halbwissen rund um die Sexualität! : 100 Fragen und Antworten für dein Sexleben

Moyle, Kate

DK, 2023

ISBN 978-3-8310-4727-7 | 2024-02-15 | 05 Psychologie

Hauptbibliothek: Freihand, 600/MS 2850 M938 [entlehnt]

Buchcover

Allgemeine und spezielle Pharmakologie und Toxikologie vorlesungsorientierte Darstellung und klinischer Leitfaden für Studium und Praxis : 2024/25

Karow, Thomas

Thomas Karow, 2023

ISBN 978-3-9821223-4-2 | 2024-02-12 | 36 Pharmazie


Beschreibung: Gliederung nach dem neuen Gegenstandskatalog der Ärztlichen Approbationsordnung, dadurch fachbezogene klinische Systematik

Hauptbibliothek: Freihand, 600/XI 1300 K18(32)+2 [verfügbar]

Buchcover

Als Mama mit der Lampe sprach meine Kindheit mit einer schizophrenen Mutter

Türkmen, Nilüfer

BoD - Books on Demand, 2023

ISBN 978-3-7583-1669-2 | 2024-02-26 | 34 Medizin und Pflege

Hauptbibliothek: Magazin HB, 742840 [verfügbar]

Buchcover

Als Wappenadler bin ich eine Schildkröte ein Otto-Grünmandl-Abend mit Musik von Franui

Tiroler Landestheater & Orchester GmbH Innsbruck, 2023

2024-02-07 | 47 Theaterwissenschaft

Hauptbibliothek: Magazin HB, 653555 [verfügbar]

Buchcover

Amphibienschutz in kleingewässerreichen Ackerbaugebieten Grundlagen, Konflikte, Lösungen

Natur & Text, 2011

ISBN 978-3-942062-02-2 | 2024-02-12 | 29 Zoologie

Bibliothekszentrum West: Freihand, 800/WR 7300 B496 [verfügbar]

Buchcover

Analyse des Eltern-Kind-Systems : Zusammenhang elterlicher Belastung und kindlicher Symptomatik

Lasserre, Désirée

Diplomarbeit, Medizinische Universität Innsbruck, 2023 - Volltext: BibSearch

2024-02-23 | 34 Medizin und Pflege

Hauptbibliothek: Magazin HB, 675743 [entlehnt]

Buchcover

Ancient Jewish Historians and the German Reich Seven Studies

Schwartz, Daniel R..

De Gruyter Oldenbourg, 2024

ISBN 978-3-11-076534-2 | 2024-02-13 | 54 Geschichte

e-Medien: https://www.degruyter.com/isbn/9783110764833

Buchcover

Angry Cripples Stimmen behinderter Menschen gegen Ableismus

Leykam, 2023

ISBN 978-3-7011-8277-0 | 2024-02-16 | 11 Soziologie und Kulturwissenschaften


Beschreibung: »Angry Cripples« werden behinderte Menschen abfällig genannt, denen vorgeworfen wird, aufgrund ihrer Behinderung verbittert zu sein. Dieses Buch fordert den Begriff zurück und besetzt ihn neu. Es kommen ausschließlich behinderte Menschen zu Wort – und viele von ihnen sind wütend darüber, wie die Gesellschaft mit ihnen umgeht. Zu Recht. Hier verschaffen sie sich Gehör, um eine inklusive Gesellschaft mitzuprägen. Sie schreiben unter anderem über Pränataldiagnostik, selbstbestimmte Sexualität, Sichtbarkeit und Social Media. Die Beiträge bilden die große Vielfalt behinderter Lebensrealität in unserer Gesellschaft ab: es gibt fiktive Texte, wissenschaftliche Beiträge, Zeich-nungen, Interviews und Brandreden. Ein beispielloses Projekt, das den hohen Wert der Selbstbestimmung zeigt und Lust macht auf eine wirklich inklusive Gesellschaft. Angry Cripples ist eine Empowerment-Plattform von behinderten Menschen für behinderte Menschen, die von den Herausgeberinnen ins Leben gerufen wurde

Hauptbibliothek: Freihand, 600/DT 1500 B977 [reserviert]

Buchcover

Animals and epidemics interspecies entanglements in historical perspective

Vandenhoeck & Ruprecht; Böhlau, 2024

ISBN 978-3-412-52572-9 | 2024-02-26 | 54 Geschichte


Beschreibung: Abstract Suspicious bats, culled mink, valuable monkeys, and vaccinated tigers: the recent global pandemic has demonstrated the close interconnectedness of animal and human lives in the modern world. The human attribution of epidemic agency to animals has a long historical tradition, as narratives about animal diseases in antiquity already attest. The contributions to this volume focus on animals as victims, hosts, or vectors of dangerous diseases – or, since the late eighteenth century, also as producers of vaccines and test bodies for new medicines. They also show how epistemic breaks such as the bacteriological turn around 1900 led to large-scale extermination campaigns against rats and other “pests”. The changing role of non-human beings in epidemics thus reflects both long continuities and fundamental shifts in relations between humans and other animals.Verdächtige Fledermäuse, gekeulte Zuchtnerze, wertvolle Versuchsaffen und geimpfte Tiger im Zoo: Die jüngste globale Pandemie hat neben der Vulnerabilität von modernen Gesellschaften auch die enge Verflochtenheit von tierlichem und menschlichem Leben eindrücklich vor Augen geführt. Die menschliche Zuschreibung von Akteursrollen von Tieren in Epidemien hat eine lange historische Tradition, wie bereits Erzählungen über Tierseuchen in der Antike belegen. Die Beiträge des Bandes legen den Fokus auf Tiere als Opfer, Wirte oder Überträger von gefährlichen Krankheiten – oder seit dem späten 18. Jahrhundert auch als Produzenten von Impfungen und Testkörper für Heilstoffe. Sie zeigen zudem auf, wie epistemische Brüche wie die bakteriologische Wende um 1900 zu großflächigen Vernichtungsaktionen gegen Ratten und andere „Schädlinge“ führten. In der sich wandelnden Rolle von Tieren in Epidemien spiegeln sich damit sowohl lange Kontinuitäten als auch fundamentale Umbrüche in den Beziehungen zwischen Menschen und anderen Tieren.

e-Medien: https://doi.org/10.7788/9783412525729

Buchcover

Arbeit und Selbstbestimmung bei Menschen mit hohem Unterstützungsbedarf : das Projekt mittendrin und sein Beitrag zu einem inklusiven Arbeitsmarkt für Menschen mit Behinderungen

Brummer, Stefanie

Masterarbeit, Universität Innsbruck, 2023 - Volltext: http://media.obvsg.at/AC17087070-1001

2024-02-19 | 07 Pädagogik


Beschreibung: ger: Die Tatsache, dass Menschen mit Behinderungen immer noch Ausschluss vom ersten, allgemeinen Arbeitsmarkt erfahren, stellt die Problemstellung dieser Forschung dar. Eine Folge dieser Exklusion, von der insbesondere auch Menschen mit hohem Unterstützungsbedarf betroffen sind ist, dass diese Diskriminierung Auswirkung auf die Selbstbestimmung einer Person hat. Dies begründet sich in der Tatsache, dass Selbstbestimmung nur möglich ist, wenn das betreffende Subjekt uneingeschränkt und ohne Diskriminierung am gesellschaftlichen Leben teilhaben kann. Diese Kombination aus Arbeit und Selbstbestimmung bei Menschen mit hohem Unterstützungsbedarf stellt das Interesse der Forschung dar. Im Rahmen eines Projekts zur Arbeitsmarktintegration, ‚mittendrin‘, wurden Nutzer:innen und pädagogische Fachkräfte durch problemzentrierte Interviews befragt. Die forschungsleitende Frage lautete: „Wie trägt das Projekt ‚mittendrin‘ dazu bei, die Selbstbestimmung von Menschen mit hohem Unterstützungsbedarf durch eine Anstellung auf dem ersten Arbeitsmarkt zu erhöhen?“ Die Forschung bezog sich auf Theorien zu Arbeitsmotiven und setzte sich mit dem Begriff Selbstbestimmung auseinander. Hier konnten das menschenrechtliche, arbeitssoziologische und subjektive Verständnis Aufschluss über die Bedeutungsvielfalt des Selbstbestimmungsbegriffs geben. Die Auswertung, welche sich an der Grounded Theory Methodologie sowie der Sequenzanalyse orientierte, konnte konkrete Aspekte in Erfahrung bringen, welche die Arbeitsmarktchancen sowie die Selbstbestimmung der Nutzer:innen beeinflussen. Als Gelingensfaktoren der Arbeitsmarktintegration und Selbstbestimmungserhöhung wurden folgende Punkte erarbeitet: Arbeitsmotive erleben, die persönliche Zukunftsplanung und das Schnuppern. Insbesondere für die Praxis sind diese Ergebnisse von Bedeutung, da sie möglichweise auch in andere Projekte übernommen oder angepasst werden könnten, um die Chancen für Menschen mit hohem Unterstützungsbedarf am ersten Arbeitsmarkt zu erhöhen.

Hauptbibliothek: Magazin HB, 675734 [verfügbar]

Buchcover

Architect Hannes Meyer and radical modernism a biography

Leidenberger, Georg

Peter Lang, 2023

ISBN 978-3-631-88984-8 | 2024-02-05 | 42 Architektur

Zentraldepot: Externmagazin I, T236618 [verfügbar]

Buchcover

Atelier Scheidegger Keller Workbook

Atelier Scheidegger Keller

Quart Verlag, 2023

ISBN 978-3-03761-279-8 | 2024-02-12 | 42 Architektur


Beschreibung: Der Band versammelt Bauten und Projekte, die seit 2009 im Atelier Scheidegger Keller entstanden sind. Die Sammlung ist keine traditionelle Architektenmonografie, sondern gleicht vielmehr dem Logbuch einer Schiffsreise, in dem alle Daten und Handlungen der Reise aufgezeichnet sind. So dokumentieren hier Modelle, Diagramme, Codes, Texte, Karten, Pläne, Skizzen, Mock-ups, Bau- und Detailpläne, Ingenieur- und Werkstattzeichnungen, Baustellenbilder und Fotoserien den Prozess und die räumliche, typologische und konstruktive Recherche. In der Summe ergibt sich ein unmittelbarer Einblick in die vielschichtige Arbeitsweise und Gedankenwelt des Ateliers Scheidegger Keller. Zu den vier realisierten Bauten zählen das viel beachtete Haus mit zwei Stützen in Wilen (2014) und das Studierendenwohnhaus Rosengarten in Zürich-Wipkingen (2020) mit seinen roh materialisierten doppelgeschossigen Hallen und Loggien.

Zentraldepot: Externmagazin I, T173380 [verfügbar]

Buchcover

Atlas für Himmelsbeobachter die 500 schönsten Deep-Sky-Objekte mit Karten und Fotos

Karkoschka, Erich

Kosmos Verlag, 2022

ISBN 978-3-440-17360-2 | 2024-02-16 | 26 Astronomie

Bibliothekszentrum West: Freihand, 800/US 1850 K18 [verfügbar]

Buchcover

Atlas of science literacy project 2061

AAAS, c2001

ISBN 978-0-87168-668-8 | 2024-02-22 | 25 Naturwissenschaften allgemein

Hauptbibliothek: Magazin HB, 800265/1 [verfügbar]

Buchcover

Auf den Spuren der Ameisen Die Entdeckung einer faszinierenden Welt

Hölldobler, Bert

Springer Spektrum, 2013

ISBN 978-3-642-32566-3 | 2024-02-28 | 58 Fachlich nicht erfasste Objekte

e-Medien: BibSearch

Buchcover

Auf der Alm

Kampfer, Angelika

Hermagoras = Mohorjeva, 2022

ISBN 978-3-7086-1266-9 | 2024-02-05 | 43 Land-, Forst- und Hauswirtschaft

Hauptbibliothek: Magazin HB, 742744 [verfügbar]

Buchcover

Ausgeblutet Roman

Kava, Alex

Cora Verl, 2008

ISBN 978-3-89941-549-0 | 2024-02-14 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742765 [verfügbar]

Buchcover

Ausgebucht! Erfolgreiches Online-Marketing für Selbstständige

Turner, Anna

Rheinwerk Verlag, 2024

ISBN 978-3-8362-9584-0 | 2024-02-26 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 473-Turn [verfügbar]

Buchcover

Auslandswahlrecht und Auslandswahlen

Selim, Philipp

Verlag Österreich, 2023

ISBN 978-3-7046-9293-1 | 2024-02-14 | 08 Recht

e-Medien: https://doi.org/10.33196/9783704692931

Buchcover

Außerstreitverfahren Grundlagen, Verfahrensablauf, Materien des Außerstreitverfahrens

Neumayr, Matthias

LexisNexis, 2023

ISBN 978-3-7007-8587-3 | 2024-02-09 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilgerichtliches Verfahren, [entlehnt]

Buchcover

Außerstreitverfahrensrecht

Deixler-Hübner, Astrid

LexisNexis, 2022

ISBN 978-3-7007-8318-3 | 2024-02-14 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilgerichtliches Verfahren, [verfügbar]

Buchcover

Automobil und Architektur ein kreativer Konflikt

Wegerhoff, Erik

Verlag Klaus Wagenbach, 2023

ISBN 978-3-8031-3733-3 | 2024-02-19 | 44 Verkehr und Mobilität

Zentraldepot: Externmagazin I, T236633 [verfügbar]

Buchcover

Autonome Lebensprojekte von jungen Migrantinnen : Die Beweggründe kolumbianischer Bildungsmigrantinnen im deutschsprachigen Raum.

Roa Vergara, Dayhane Vanessa

Masterarbeit, Universität Innsbruck, 2024 - Volltext: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-146512

2024-02-22 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Die vorliegende Masterarbeit, die im Rahmen des Masterstudiengangs „Gender, Kultur und sozialer Wandel“ erstellt wurde, befasst sich mit internationaler weiblicher Migration. Sie rekonstruiert die Migrationserfahrungen junger Frauen aus Kolumbien, die ab den 2015er Jahren nach Österreich und/oder nach Deutschland gekommen sind. Ziel der Arbeit ist es zunächst, die Strategien zu erkennen, die die Frauen entwickelt haben, um ihre Lebensprojekte außerhalb des Landes, in dem sie geboren und aufgewachsen sind, zu realisieren. In einem zweiten Schritt werden die Auswirkungen des Migrationsprozesses auf Selbstwirksamkeit und Selbsteinschätzung sowie auf Agency- und Empowerment-Erfahrungen analysiert. Für die Studie wurde eine qualitative Forschungsstrategie gewählt: Mithilfe offener, problemzentrierter Interviews wurden insgesamt sechs kolumbianische Frauen im Alter zwischen 24 und 31 Jahren, die sich aus unterschiedlichen Gründen und auf unterschiedlichen Wegen zur Migration nach Europa entschlossen haben, befragt. Die Studie zeigt anhand sechs ausführlicher Fallvignetten, dass der Migrationsprozess die Fähigkeit der Teilnehmerinnen gestärkt hat, sich selbstständig verschiedenen Herausforderungen zu stellen und im Umgang mit den Widrigkeiten ihre Widerstandsfähigkeit und Handlungsfähigkeit zu erweitern. Darüber hinaus hat der Migrationsprozess das kritische Denken der Teilnehmerinnen in Bezug auf ihre im Herkunftsland erworbenen Überzeugungen und hinsichtlich ihrer Position als Migrantin im Aufnahmeland gefördert und sie in die Lage versetzt, alltäglichen Stereotypisierungen und Diskriminierungen aus einer (selbst)bewussteren Position heraus zu begegnen.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-146512

Buchcover

Autorität und autoritäre Strukturen : Reflexionen aus reformiert-theologischer Perspektive

Konsultation Reformierter Ungarisch- und Deutschsprachiger Theologen und Theologinnen Debrecen 2022 6.

Vandenhoeck & Ruprecht, 2024

ISBN 978-3-666-50033-6 | 2024-02-28 | 06 Religion, Theologie

e-Medien: https://doi.org/10.13109/9783666500336

Buchcover

AUVB allgemeine Bedingungen für die Unfallversicherung

Maitz, Ewald

Verlag Österreich, 2023

ISBN 978-3-7046-9300-6 | 2024-02-15 | 08 Recht

e-Medien: https://doi.org/10.33196/9783704693006

Buchcover

AVG I Allgemeines Verwaltungsverfahrensgesetz Praxiskommentar

Linde Verlag GesmbH, 2024

ISBN 978-3-7073-4600-8 | 2024-02-29 | 08 Recht

e-Medien: https://www.lindedigital.at/plink/ko-avg-2

Buchcover

Bären Grizzly, Panda, Eisbär

Mayer, Alexandra

Tessloff, 2017

ISBN 978-3-7886-2104-9 | 2024-02-19 | 29 Zoologie

Bibliothekszentrum West: Lesesaal, N30717/115 [verfügbar]

Buchcover

Balkonkraftwerke verstehen und einfach einsteigen

Rippel, Jörg

Rheinwerk, 2023

ISBN 978-3-8362-9843-8 | 2024-02-12 | 37 Technik allgemein

Bibliothekszentrum West: Freihand, 800/ZP 3731 R593 [verfügbar]

Buchcover

Bauhaus in Berlin eine fotografische Reise durch die Klassische Moderne

Molitor, Jean

BeBra Verlag, 2023

ISBN 978-3-8148-0278-7 | 2024-02-19 | 42 Architektur

Zentraldepot: Externmagazin I, T236631 [verfügbar]

Buchcover

BDG | Beamten-Dienst­rechtsgesetz

Loibl-van Husen, Susanna

Linde Verlag GesmbH, 2024

ISBN 978-3-7073-3694-8 | 2024-02-29 | 08 Recht

e-Medien: https://www.lindedigital.at/plink/ko-bdg-2

Buchcover

Begeisterung der Materie eine exemplarische Texthermeneutik im Geiste einer responsiven Phänomenologie

Schulz-Nieswandt, Frank

Nomos, 2024

ISBN 978-3-7489-1892-9 | 2024-02-26 | 04 Philosophie

e-Medien: https://doi.org/10.5771/9783748918929

Buchcover

Behavioural economics and the environment a research companion

Routledge Taylor & Francis Group, 2023

ISBN 978-1-003-17274-1 | 2024-02-23 | 58 Fachlich nicht erfasste Objekte

e-Medien: https://doi.org/10.4324/9781003172741

Buchcover

Betriebsübergreifende Zusammenarbeit von Betriebsräten Reichweite und Grenzen der Amtsausübung am Beispiel von Unternehmen mit Filialstruktur

Frank, Michael

Nomos, 2023

ISBN 978-3-7560-1141-4 | 2024-02-12 | 08 Recht

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Betrug zum Nachteil der finanziellen Interessen der Europäischen Union die Umsetzung der PIF-RL durch § 168f StGB und § 40 FinStrG

Flörl, Thomas

Linde, 2023

ISBN 978-3-7073-4908-5 | 2024-02-19 | 08 Recht

Fachbibliothek Recht: Bibliothek für Strafrecht, Strafprozessrecht und Kriminologie, [verfügbar]

Buchcover

Bewältigung des Scheiterns Autobiographische Schriften früherer Parteifunktionäre von NSDAP und SED

Danner, Hans-Ulrich

De Gruyter Oldenbourg, 2024

ISBN 978-3-11-134010-4 | 2024-02-13 | 54 Geschichte


Beschreibung: Deutschland erlebte im 20. Jahrhundert mit dem Dritten Reich und der DDR zwei Diktaturen, die die Bundesrepublik bis heute prägen. Dennoch wurde die Nachkriegsperspektive der führenden Akteure beider Regime im Gegensatz zu derjenigen der Opfer, Generäle, Literaten oder Wissenschaftler in der historischen Forschung kaum beachtet. Hans-Ulrich Danner wertet erstmals sämtliche Autobiographien der bedeutendsten Parteifunktionäre von NSDAP und SED in einer vergleichen Studie aus. Dabei werden die Verarbeitungsstrategien, die Kritik an System und Ideologie, die Erklärungen für das Scheitern sowie die Einordnung der eigenen Rolle der Verfasser untersucht. Die zusammenfassenden Analysen zu jedem Memoirenschreiber und die systemübergreifende Typologie sind das Hauptergebnis der Arbeit. Es werden sowohl Gemeinsamkeiten als auch Unterschiede in der Vergangenheitsbewältigung durch die NS- und SED-Autoren aufgezeigt. Gerade wegen der historischen und politischen Relevanz des bislang unerforschten Themas ist das Buch für die Wissenschaft von Bedeutung. Besonders dem interessierten Leser wird durch den Fokus auf die Funktionsträger der Regime eine neue Perspektive auf die deutsche Diktaturerfahrung geboten

e-Medien: https://doi.org/10.1515/9783111340104

Buchcover

Bewertungen auf digitalen Plattformen zur Auflösung von Grundrechtskollisionen im digitalen Raum

Wickede, Hannah von 19XX-

Nomos, 2023

ISBN 978-3-7560-1165-0 | 2024-02-12 | 08 Recht

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Beyond quick fixes adressing the complexity & uncertainties of contemporary society

Rouse, William B.

Oxford University Press, 2023

ISBN 978-0-19-199662-7 | 2024-02-20 | 58 Fachlich nicht erfasste Objekte

e-Medien: https://doi.org/10.1093/oso/9780198892533.001.0001

Buchcover

Bilder des Krieges Darstellung und Kommunikation des Krieges im Digitalen Zeitalter

Büchner, 2023

ISBN 978-3-96317-330-1 | 2024-02-26 | 02 Publizistik und Kommunikation

Hauptbibliothek: Freihand, 600/AP 26880 G727 [verfügbar]

Buchcover

Bildsprache und Nutzungskontexte des rheinischen Steinzeugs in der Frühen Neuzeit

Pfeiffer, Sören

Rheinische Friedrich-Wilhelms-Universität Bonn, 2023

ISBN 978-3-936490-27-5 | 2024-02-23 | 55 Archäologie

Fachbibliothek Altertumswissenschaften: Freihand, 650/NF 7205 P526 [verfügbar]

Buchcover

Bildung als Herausforderung Grundlagen für die Pädagogik bei Verhaltensstörungen

Verlag Julius Klinkhardt, 2023

ISBN 978-3-7815-6001-7 | 2024-02-19 | 07 Pädagogik


Beschreibung: Neben Erziehung stellt Bildung die zweite Kernaufgabe professionellen pädagogischen Handelns dar. Für den Kontext Verhaltensstörungen ist dieses Thema und sein Potenzial im Hinblick auf die Entwicklung junger Menschen, aber auch im Hinblick auf die Organisationsentwicklung von Schule und anderen pädagogischen Institutionen bisher deutlich zu wenig beleuchtet worden. In diesem Buch soll der Zusammenhang von Bildung und Verhaltensstörungen aus einer interaktionistischen Perspektive heraus betrachtet werden: zum einen mit Blick auf die Relevanz von Bildung für junge Menschen mit Auffälligkeiten des Erlebens und Verhaltens - zum anderen mit kritischem Fokus auf gesellschaftliche und institutionalisierte Bildungsangebote, für die Störungen auch einen Entwicklungsbedarf aufzeigen können. Im Band sind zahlreiche Stimmen aus der engeren und weiteren Fachszene versammelt, welche die Vielschichtigkeit einer Bildung als Herausforderung im Kontext der Pädagogik bei Verhaltensstörungen beleuchten. Das Buch richtet sich an Sonderpädagoginnen und Sonderpädagogen aus Forschung und Praxis sowie ebenso an andere erziehungs- und bildungswissenschaftlich Interessierte, die sich vertiefend mit Bildungshorizonten bei Verhaltensstörungen befassen möchten.

e-Medien: https://elibrary.utb.de/doi/book/10.35468/9783781560017

Buchcover

Bildung und Kultur Gegenwart und Zukunft eines deutschen Deutungsmusters

Beltz Juventa, 2024

ISBN 978-3-7799-7660-8 | 2024-02-08 | 07 Pädagogik


Beschreibung: Freiheit und Verantwortung bilden seit der Aufklärung des 18. Jahrhunderts ein offenes Spannungsgefüge im Selbst- und Weltverhältnis des Menschen. Wir leben seitdem in einer Art Laboratorium, in dem anhand von Signaturen wie Bildung und Kultur Mensch-Sein und Mensch-Werdung immer wieder neu gesellschaftlich ausgehandelt werden müssen. Pluralitätsoffen, aber nicht entgrenzt beliebig – unter diesen Vorzeichen wurde zur Erforschung dieses Zusammenhangs an der Universität Jena das Institut für Bildung und Kultur (IBK) gegründet. Der Band dokumentiert im IBK entwickelte Zugänge zum Verhältnis von »Bildung - Kultur - Anthropologie«, das auch in einem gleichnamigen Master-Programm interdisziplinär gelehrt wird. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 571-Bild|c [verfügbar]

Buchcover

Bioadhesion in Hydra Proteins and glycans in the glue of freshwater cnidarians

Ofer, Julia

2024

2024-02-22 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Die Fähigkeit, sich an Oberflächen anzuheften, kommt bei verschiedenen Taxa vor. Abhängig von den spezifischen Anforderungen haben Organismen dafür unterschiedliche molekulare Mechanismen entwickelt. Das Süßwassernesseltier Hydra ist in der Lage, sich vorübergehend an Oberflächen Unterwasser anzuheften. Die Anheftung erfolgt mithilfe eines Klebstoffs, der hauptsächlich aus Proteinen und Glykanen besteht und von den Zellen der Basalscheibe an der Basis des Tieres sekretiert wird. Der Klebstoff ist stark und haftet in feuchten Bereichen. Er ist daher ein vielversprechender Kandidat, um herkömmliche, oft toxische Klebstoffe zu ersetzen. In dieser Arbeit führten in silico Analysen in Kombination mit Knockdown-Experimenten von sieben an der Adhäsion beteiligten Proteinen zur Identifizierung von AbfB ABD 2 als Schlüsselprotein für die Adhäsion von H. vulgaris. Die Ergebnisse bioinformatischer Analysen deuten darauf hin, dass dieses Protein eine konservierte Rolle bei der Adhäsion innerhalb der Gattung Hydra einnimmt. Für Glykane wurden hingegen andere Ergebnisse berichtet. Fußabdruckfärbungen zeigten Unterschiede in den Glykanintensitäten zwischen den Arten. Im Gegensatz dazu ergaben die intraspezifischen Analysen bei H. oligactis keine Hinweise auf Anpassungen des Klebstoffs an unterschiedliche Lebensbedingungen. Trotz bioinformatischer Vorhersagen wurden die posttranslationalen Aminosäuremodifikationen Phosphoserin und Sulfotyrosin, von denen bekannt ist, dass sie eine Schlüsselrolle im Adhäsionsprozess anderer Organismen spielen, weder im Fußabdruck noch im Fußgewebe von H. vulgaris gefunden. Alle diese Experimente bieten Ansatzpunkte für weitere Forschungen zum Hydra-Klebstoff.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-144358

Buchcover

Biochemische und physiologische Versuche mit Pflanzen für Studium und Unterricht im Fach Biologie

Wild, Aloysius

Springer Spektrum, 2012

ISBN 978-3-8274-2818-9 | 2024-02-09 | 28 Botanik

Bibliothekszentrum West: Depot BZW, N30707 [verfügbar]

Buchcover

Bitternis Roman

Bator, Joanna

Suhrkamp Verlag, 2023

ISBN 978-3-518-43131-3 | 2024-02-26 | 56 Belletristik und Spielfilme

Hauptbibliothek: Freihand, 600/KP 9920 B334 B62.2024 [verfügbar]

Buchcover

Blattläuse – Aphidoidea

Thieme, Thomas

Militzke, 2024

ISBN 978-3-89432-890-0 | 2024-02-19 | 29 Zoologie

Bibliothekszentrum West: Freihand, 800/WQ 7970 T433 [entlehnt]

Buchcover

Blutiger Freitag Roman

Kava, Alex

Cora-Verl, 2010

ISBN 978-3-89941-683-1 | 2024-02-22 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742815 [verfügbar]

Buchcover

Blutspur des Todes : Roman

Kava, Alex

Cora-Verl, 2004

ISBN 978-3-89941-148-5 | 2024-02-22 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742813 [verfügbar]

Buchcover

Bournville ein Roman in sieben Ereignissen

Coe, Jonathan

Folio Verlag, 2023

ISBN 978-3-85256-885-0 | 2024-02-16 | 58 Fachlich nicht erfasste Objekte

Hauptbibliothek: Magazin HB, 742857 [verfügbar]

Buchcover

Break no bones

Reichs, Kathy

Arrow Books, 2007

ISBN 978-0-09-944151-9 | 2024-02-12 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742777 [verfügbar]

Buchcover

Breaking Creed

Kava, Alex

sphere, 2015

ISBN 978-0-7515-5581-3 | 2024-02-08 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742733 [verfügbar]

Buchcover

Bücher bewegen 375 Jahre Forschungsbibliothek Gotha : Katalog zur Jubiläumsausstellung auf Schloss Friedenstein Gotha vom 10. April bis 19. Juni 2022

Forschungsbibliothek Gotha der Universität Erfurt, 2022

ISBN 978-3-910027-41-1 | 2024-02-16 | 03 Information und Dokumentation, Buch- und Bibliothekswesen

Hauptbibliothek: Sondersammlungen Lesesaal, 388629 [verfügbar]

Buchcover

Bürgerliches Recht

Österreich

LexisNexis, 2024

ISBN 978-3-7007-8809-6 | 2024-02-26 | 08 Recht

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Building a book of books textual characteristics of the early Greek majuscule pandects

Dormandy, Michael ca. 20./21. Jh.

De Gruyter, 2024

ISBN 978-3-11-099457-5 | 2024-02-14 | 06 Religion, Theologie

Fachbibliothek Theologie: Freihand, 206-M74 DORM [entlehnt]

Buchcover

Business 5.0 der Praxis-Guide für Künstliche Intelligenz in Unternehmen – Chancen und Risiken

Köhler, Thomas R.

Campus Verlag, 2024

ISBN 978-3-593-51867-1 | 2024-02-08 | 13 Betriebswirtschaft


Beschreibung: Endlich ist er da, der Durchbruch für Künstliche Intelligenz (KI) bzw. Artificial Intelligence (AI). Doch Zweifel an der »Universalwaffe« ChatGPT und ähnlichen KI-Systemen sind erlaubt. Thomas R. Köhler und Julia Finkeissen liefern in ihrem neuen Buch eine Bestandsaufnahme der aktuellen Technologien und trennen dabei schonungslos Hype von Wirklichkeit. Sie liefern das Rüstzeug für jede Führungskraft, um KI aktiv im Unternehmen sinnvoll einzusetzen. Business 5.0 zeigt in sieben Schritten, wo und wie KI-Projekte im Unternehmen etabliert werden können, und liefert konkrete Beispiele für unterschiedliche Branchen und Querschnittsfunktionen. Ein nachhaltiger KI-Einsatz im Unternehmen steht dabei im Mittelpunkt. (https://www.buchhandel.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 506-Köhl [verfügbar]

Buchcover

Business culture design develop your corporate culture with the culture map

Sagmeister, Simon

Campus Verlag, 2023

ISBN 978-3-593-51890-9 | 2024-02-08 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 336-Sagm [verfügbar]

Buchcover

Business research methods

Bell, Emma

Oxford University Press, 2022

ISBN 978-0-19-886944-3 | 2024-02-28 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: MCI-I, Universitätsstr. 15, 071-Bell|b [verfügbar]

Buchcover

Career & family women's century-long journey toward equity

Goldin, Claudia

Princeton University Press, 2023

ISBN 978-0-691-22866-2 | 2024-02-16 | 09 Politik

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Carlos Martinez

Quart, 2023

ISBN 978-3-03761-272-9 | 2024-02-14 | 42 Architektur


Beschreibung: Seit über 30 Jahren führt Carlos Martinez in Berneck sein Architekturbüro. Bekannt geworden ist er durch den zusammen mit Pipilotti Rist entwickelten «roten Teppich von St. Gallen» – eine wundersame städtebauliche Intervention, die ein ehemals zerklüftetes Konglomerat von Restflächen und Verkehrsfunktionen zu einem homogenen, identitätsstiftenden Ganzen zusammenfasst. Mit viel Verve und in intensiver und lustvoller Auseinandersetzung mit dem städtebaulichen Kontext und dem Bestand sind in den letzten drei Dekaden zahlreiche architektonische Projekte entstanden, die sich als starke Figuren in die Stadt und Landschaft einfügen.

Zentraldepot: Externmagazin I, T173382 [verfügbar]

Buchcover

Causal analysis impact evaluation and causal machine learning with applications in R

Huber, Martin

The MIT Press, 2023

ISBN 978-0-262-54591-4 | 2024-02-21 | 10 Wirtschafts- und Sozialwissenschaften allgemein

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 921-Hube [entlehnt]

Buchcover

Cellini and the principles of sculpture

Cole, Michael Wayne

Cambridge Univ Press, 2002

ISBN 978-0-521-81321-1 | 2024-02-21 | 45 Kunst

Hauptbibliothek: Freihand, 600/LI 21750 C689 [verfügbar]

Buchcover

CEO Human Capital and Succession Outcomes : The Relationship of Prior Experience and post-succession Performance

Ghesla, Marina

Diplomarbeit, Universität Innsbruck, 2024 - Volltext: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-145570

2024-03-01 | 58 Fachlich nicht erfasste Objekte


Beschreibung: eng: Bringing in a new CEO is a crucial event to any organisation and a controversial topic in management literature. With a new person, new human capital is brought into the CEO position as successors differ in their origin (e.g. outsider) or their previous jobs (e.g. prior CEOs). While diverse backgrounds are intuitively associated with advantages, the seamless transfer of human capital to a new organisational context is not universally straightforward. Consequently, the viability of hiring these successors is frequently questioned. This study delves into analysing the relationship between human capital of prior CEO experience and CEO origin, and its influence on post-succession firm performance. The work follows quantitative research on 356 succession events of S&P 500 firms (2005-2014). Using OLS regression analysis, significant insights emerged, challenging the expectations of immediate benefits from broad CEO experience backgrounds. Findings on outsider CEOs align with existing literature showing significant negative effects on performance, while prior job-specific experience shows a negative tendency, without being significant. The findings further indicate that negative effects are weaker with longer CEO tenure. Hence, the study emphasises the enduring value of firm-specific knowledge over job-specific skills, highlighting that while immediate gains may not be apparent, negative effects on post-succession performance tend to alleviate. The findings contribute to the research of CEO succession and by investigating the influence of top-level management on organisational performance refers to the Upper Echelons theory. By comparing job- and firm-specific knowledge, it further contributes to human capital literature focusing on the transferability of human capital.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-145570

Buchcover

Characterization of photoresist adhesion to copper for wet chemical etching applications

Modl, Julia

2023

2024-02-15 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Diese Arbeit beschäftigt sich mit der Charakterisierung der Haftung von Fotolacken auf Kupferoberflächen während des nasschemischen Ätzens. Die größte Herausforderung war die Auswahl einer geeigneten Methode zur Bewertung der Fotolack-Haftung angesichts der einzigartigen Beschaffenheit des Fotolack-Kupfer Systems. Die Sprödigkeit des Fotolacks bei längerem oder starkem Ausheizen machte die Pull-Off-Adhäsionsmethode ungeeignet und die unterschiedlichen Eigenschaften der verschiedenen Fotolackformulierungen schränkten die Anwendbarkeit der Schertests ein. br /br /Die Indentationsmethode erwies sich als vielversprechend, da sie die Erzeugung der für die Haftungsberechnung erforderlichen Delaminationen in der Fotolackschicht ermöglichte. Die Entwicklung eines geeigneten Modells zur Berechnung der Adhäsion erwies sich jedoch als schwierig. Bestehende Modelle sind auf bestimmte Materialsysteme zugeschnitten und enthalten nicht anwendbare Näherungen. Für zuverlässige Ergebnisse wäre ein eigens erstelltes Modell notwendig, das den Beitrag des Kupfersubstrats zur Delamination berücksichtigt. br /br /Eine wirksame Methode zur Bewertung der Fotolack-Haftung beim nasschemischen Ätzen bestand in der Bewertung der resultierenden Kupferprofile. Die Steilheit der Kupferätzwinkel lieferte zuverlässige Indikatoren für die Haftung des Fotolacks auf dem Kupfersubstrat, wobei auch der Einfluss verschiedener Vorbehandlungen der Kupferoberfläche berücksichtigt wurde. br /br /Durch die Verwendung bifunktionaler Moleküle als Haftvermittler, die kovalente Bindungen mit Kupfer eingehen, wurde eine deutlich verbesserte Haftung zwischen Fotolack und Kupfer erreicht. Durch die Integration solcher Haftvermittler in den Fotolack, wie mit AZ TD2010 von Merck KGaA demonstriert, entfiel die Notwendigkeit des zusätzlichen Auftragens und Strukturierens einer Haftvermittlerschicht. br /br /Der Vergleich von AZ TD2010 mit anderen Fotolacke zeigte unterschiedliche Reaktionen auf die Eigenschaften der Kupferoberfläche. Eine metalloxidfreie Oberfläche begünstigte die Bindung Haftvermittlers in AZ TD2010. Die Vorbehandlung mit Zitronensäure und die dadurch bedingte Entfernung von Kupferoxiden verbesserte die Haftung beim nasschemischen Ätzen erheblich. Andere Vorbehandlungen, wie z. B. TMAH-Spülungen, zeigten weniger Wirkung, während die Sauerstoffplasmavorbehandlung die natürliche Kupferoxidschicht verstärkte. br /br /Die fotolithografischen Parameter, insbesondere der Hard Bake, hatten einen erheblichen Einfluss auf die Haftung des Fotolacks und beeinflusste auch die Fotolackprofile. Der Soft Bake und der Post Exposure Bake hatten geringere Auswirkungen auf die Haftung, obwohl der Soft Bake bei bestimmten Temperaturen die Reaktion zwischen Haftvermittler und Kupferoberfläche sicherstellte. Die Einstellungen für den Soft Bake und den Post Exposure Bake beeinflussten auch die Fotolack-Profile, während die Profile des geätzten Kupfers unbeeinflusst blieben. br /br /Die Rehydrationszeit zwischen Soft Bake und Belichtung war entscheidend für die Verarbeitung dicker Fotolacke (5-9 µm), denn sie wirkte sich auf die Lichtempfindlichkeit und den Durchsatz bei der Herstellung von Mikrochips aus. br /br /Um einheitliche und reproduzierbare Ätzergebnisse zu erzielen, war eine ausreichende Benetzung des hydrophoben AZ TD2010 mit der Ätzlösung erforderlich. Eine Sauerstoffplasma-Vorbehandlung zwischen dem Hard Bake und dem nasschemischen Ätzen verbesserte die Benetzung, da hydrophile Oberflächengruppen erzeugt wurden.br /br /Insgesamt zeigte die Anwendung von AZ TD2010 auf produktiven Substraten sowohl Vorteile als auch Grenzen auf. Die fotolithografischen Parameter mussten für Substrate mit ausgeprägter Kupfertopografie angepasst werden und das nasschemische Kupferätzen mit aggressiven Chemikalien barg das Risiko von Rissen im Fotolack und unerwünschter Kupferätzung.

e-Medien: https://ulb-dok.uibk.ac.at/9132053

Buchcover

ChatGPT im Geschichtsunterricht

Held, Oliver

Wochenschau Verlag, 2024

ISBN 978-3-7344-1603-3 | 2024-02-05 | 54 Geschichte

Hauptbibliothek: Magazin HB, 388624 [verfügbar]

Buchcover

Codice civile e delle leggi complementari annotato con la giurisprudenza

Garofoli, Roberto

Neldiritto Editore, 2023

2024-02-23 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Codice civile e di procedura civile e leggi complementari

LaTribuna, 2024

ISBN 978-88-291-1431-3 | 2024-02-23 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Codice civile e leggi complementari

La Tribuna, 2024

ISBN 978-88-291-1429-0 | 2024-02-22 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Codice del consumo cosa cambia

Capilli, Giovanna

Giuffrè Francis Lefebvre, 2023

ISBN 978-88-288-5571-2 | 2024-02-12 | 08 Recht

Fachbibliothek Recht: Bibliothek für Internationales Privatrecht, [verfügbar]

Buchcover

Codice delle successioni e donazioni

Giuffrè Francis Lefebvre, 2023

ISBN 978-88-288-3708-4 | 2024-02-23 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Codice di procedura civile e leggi complementari

La Tribuna, 2024

ISBN 978-88-291-1439-9 | 2024-02-22 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Comparative politics

Oxford University Press, 2023

ISBN 978-0-19-284605-1 | 2024-02-16 | 09 Politik

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 731-Comp|b [verfügbar]

Buchcover

Costituzione e politica appunti per una nuova stagione di riforme costituzionali

Cheli, Enzo

Sotietà editrice il Mulino, 2023

ISBN 978-88-15-38633-5 | 2024-02-15 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Öffentliches Recht, [verfügbar]

Buchcover

Covid Hilfsmaßnahmen eine betriebswirtschaftliche Analyse

Caputo, Davide

2023

2024-02-22 | 58 Fachlich nicht erfasste Objekte

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-141742

Buchcover

Creation (Pictures for Dorian)

Tiroler Landesorchester & Orchester GmbH Innsbruck, 2023

2024-02-07 | 47 Theaterwissenschaft

Hauptbibliothek: Magazin HB, 653561 [verfügbar]

Buchcover

Crypto-asset regolamento MiCA e DLT pilot regime : analisi ragionata su token, stablecoin, CASP

Giuffrè Francis Lefebvre, 2023

ISBN 978-88-288-5118-9 | 2024-02-22 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Cultural policy beyond the economy : work, value, and the social

Stevenson, Deborah,,

Edward Elgar Publishing, 2023

ISBN 978-1-78897-466-0 | 2024-02-01 | 10 Wirtschafts- und Sozialwissenschaften allgemein

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 742-Stev [verfügbar]

Buchcover

Damned good show a novel

Robinson, Derek

Cassell, 2002

ISBN 978-0-304-36310-0 | 2024-02-06 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742701 [verfügbar]

Buchcover

Das Ausrufezeichen : eine rebellische Geschichte

Hazrat, Florence

HarperCollins, 2024

ISBN 978-3-365-00488-3 | 2024-02-15 | 15 Allgemeine Sprach- und Literaturwissenschaft

Hauptbibliothek: Magazin HB, 742817 [verfügbar]

Buchcover

Das entfesselte Jahrzehnt Sound und Geist der 70er

Balzer, Jens

Rowohlt Berlin, Juni 2019

ISBN 978-3-7371-0049-6 | 2024-02-26 | 54 Geschichte

Bibliothek Haus der Musik: Freihand, O.22-37 [reserviert]

Buchcover

Das Grauen : Roman

Kava, Alex

Cora-Verl, 2002

ISBN 978-3-89941-032-7 | 2024-02-22 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742812 [verfügbar]

Buchcover

Das große Buch der Strategie von der Reformation bis zur digitalen Transformation

Franz Vahlen GmbH, 2024

ISBN 978-3-8006-7197-7 | 2024-02-15 | 13 Betriebswirtschaft


Beschreibung: Das großen Wimmelbuch der Strategie baut auf einem einfachen Gedanken auf. Strategien und die daraus sich entwickelnden Transformationen sind nicht mehr und nicht weniger als die spannende Geschichte, die eine Organisation über ihre eigene Zukunft erzählt. Und diese Geschichte kann man malen. So entsteht aus einer Strategie, das was Millionen von Mitarbeitenden in allen Unternehmen in der Umgangssprache ständig fordern beim Thema Strategie: "Zeig mir das große Ganze, ich will das Big Picture verstehen." Das große Wimmelbuch der Strategie" nimmt diese Sehnsucht nicht nur ernst, sondern auch wörtlich und zeigt anhand von ausgewählten Beispielen von der Reformation bis zur digitalen Transformation, wie selbst die größten und komplexesten Strategien als Big Picture visualisiert werden können, und wie es gelungen ist mit diesem ungewöhnlichen Ansatz Millionen von Menschen auf die Reise in eine erstrebenswerte Zukunft mitzunehmen. (https://www.buchhandel.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 313-Wres [verfügbar]

Buchcover

Das große Handbuch Qualitätsmanagement in der Kita

Carl Link, 2023

ISBN 978-3-556-09694-9 | 2024-02-21 | 07 Pädagogik

Hauptbibliothek: Freihand, 600/DK 2000 S895(2) [verfügbar]

Buchcover

Das Grundbuch in der Praxis das ABC der Grundbuchseintragungen

Jauk, Anton

LexisNexis, 2023

ISBN 978-3-7007-8586-6 | 2024-02-12 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Das kaiserzeitliche Gräberfeld von Mechau, Altmarkkreis Salzwedel ein Beitrag zur sozialen Identität von Kleingruppen

Michel, Florian

Landesamt für Denkmalpflege und Archäologie Sachsen-Anhalt - Landesmuseum für Vorgeschichte, 2023

ISBN 978-3-948618-60-5 | 2024-02-13 | 55 Archäologie

Fachbibliothek Altertumswissenschaften: Freihand, 650/LE 7231 M486 M6 [verfügbar]

Buchcover

Das Kollisionsrecht der kollektiven Rechtewahrnehmung

Sutterer, Moritz

Nomos, 2024

ISBN 978-3-7489-4322-8 | 2024-02-26 | 08 Recht

e-Medien: https://doi.org/10.5771/9783748943228

Buchcover

Das poetischste Land der Erde : Mexiko in der deutschsprachigen Literatur des 18.-21. Jahrhunderts

Rall, Dietrich

Edition Tandem, 2023

ISBN 978-3-904068-87-1 | 2024-02-16 | 18 Romanistik

Hauptbibliothek: Magazin HB, 742801 [verfügbar]

Buchcover

Das preisgegebene Herz ein Roman über Wiener Großbürger und Tiroler Kleinbürger

Schey, Fritz

innsbruck university press, 2022

ISBN 978-3-99106-065-9 | 2024-01-31 | 56 Belletristik und Spielfilme

Brenner-Archiv: Bibliothek, III-4279,2.Ex. [verfügbar]

Buchcover

Das Recht der Erde eine Erzählung über den Boden, der uns trägt

Davodeau, Étienne

Carlsen Comics, 2023

ISBN 978-3-551-77130-8 | 2024-02-08 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 388614 [verfügbar]

Buchcover

Das Recht des Untersuchungsausschusses B-VG, GOG-NR, VO-UA, StGB, Medienrecht

Jedliczka, Ulrich

Verlag Österreich, 2023

ISBN 978-3-7046-9350-1 | 2024-02-15 | 08 Recht

e-Medien: https://doi.org/10.33196/9783704693501

Buchcover

Das Robinson-Paradox Kapitalismus und Gesellschaft

Flahault, François

Matthes & Seitz, 2024

ISBN 978-3-7518-3001-0 | 2024-02-26 | 10 Wirtschafts- und Sozialwissenschaften allgemein

Hauptbibliothek: Freihand, 600/MS 4745 F575 [verfügbar]

Buchcover

Das Schöne : 59 Begeisterungen

Köhlmeier, Michael

Hanser, 2023

ISBN 978-3-446-27752-6 | 2024-02-13 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742809 [verfügbar]

Buchcover

Das Schweigen des Sammlers Roman

Cabré, Jaume

Insel Verl, 2016

ISBN 978-3-458-35926-5 | 2024-02-26 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742828 [verfügbar]

Buchcover

Das Stiftungs- und Spendenwesen im Islam

Topbä, Osman Nuri

Erkam-Verl, 2006

ISBN 978-9944-381-65-9 | 2024-02-14 | 06 Religion, Theologie

Fachbibliothek Theologie: Freihand, ITR 06-070 TOPB [verfügbar]

Buchcover

Das Teenager-Gehirn die entscheidenden Jahre unserer Entwicklung

Blakemore, Sarah-Jayne

S Fischer, 2018

ISBN 978-3-10-397216-0 | 2024-02-12 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CQ 6600 B636 [verfügbar]

Buchcover

Das Upgrade fürs Haus besser umbauen, renovieren und sanieren

Die Gestalten Verlag GmbH & Co KG, 2023

ISBN 978-3-96704-113-2 | 2024-02-12 | 42 Architektur

Bibliothekszentrum West: Freihand, 800/ZH 7050 K63 [verfügbar]

Buchcover

Das vergessene Appeasement von 1920 Lloyd George, Lenin und Polen

Nowak, Andrzej

De Gruyter, 2024

2024-02-13 | 54 Geschichte

e-Medien: BibSearch

Buchcover

Das Verlassenschaftsverfahren

Fucik, Robert

MANZ'sche Verlags- und Universitätsbuchhandlung, 2023

ISBN 978-3-214-25410-0 | 2024-02-09 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilgerichtliches Verfahren, [verfügbar]

Buchcover

Data inspired Erfolgskonzepte für die datengetriebene Organisation : Datenstrategie : Mindset & Kultur : Künsltiche Intelligenz

Wernicke, Sebastian

Verlag Franz Vahlen, 2024

ISBN 978-3-8006-7129-8 | 2024-02-19 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 504-Wern [verfügbar]

Buchcover

Datenschutzrecht Jahrbuch 2023

NWV, 2024

ISBN 978-3-7083-4203-0 | 2024-02-15 | 08 Recht

e-Medien: https://doi.org/10.37942/9783708342030

Buchcover

Dauerwald - leicht gemacht! ein Kurzleitfaden für den selbstbewirtschaftenden Waldbesitz, für Studierende und Forstwirte sowie alle, denen die Zukunft des Waldes am Herzen liegt

Bode, Wilhelm

Natur & Text, 2021

ISBN 978-3-942062-54-1 | 2024-02-06 | 28 Botanik

Bibliothekszentrum West: Freihand, 800/WI 5300 B666 [verfügbar]

Buchcover

Debates around abortion in the global north Europe, North America, Russia and Asia

Portier-Le Cocq, Fabienne

Taylor & Francis Group, 2022

ISBN 978-1-003-18085-2 | 2024-02-29 | 11 Soziologie und Kulturwissenschaften


Beschreibung: Cover -- Half Title -- Series -- Title -- Copyright -- Contents -- List of Figures -- List of Tables -- List of Contributors -- Acknowledgements -- 'Women's Legal Rights to Abortion: Watch Out!' -- Part 1 Abortion in Historical Context -- 1 Debating Therapeutic Abortion in Nineteenth-Century Belgium -- 2 The 'Birth' of a Modern Nation: A Brief History of Women's Access to Abortion in China -- Part 2 Abortion, Politics, and Social Policy -- 3 Abortion: The Contraception Paradox in England -- 4 A Bilingual Analysis of Canada's Bill C-484: The Unborn Victims of Crime Act -- Part 3 Abortion and Legislation -- 5 Birth Control Policies and Abortion Issues in Post-Communist Russia -- 6 Abortion Law in Italy: A Pluralist Legislation Lacking Effectiveness? -- Part 4 Abortion, Culture, and Traditions -- 7 Rising Tides, Ebbing Tides: Appeasement Rituals Around Perinatal Death in Contemporary Japan -- 8 The Evolving Personhood of the Foetus in Taiwan Within the Transnational Flow -- Part 5 The Role of Healthcare Professionals -- 9 Abortion Versus Contraception: The Roots of a Terminological Professional Debate -- 10 Abortion in Times of the Covid-19 Pandemic -- Index.

e-Medien: https://doi.org/10.4324/9781003180852

Buchcover

Dei conferimenti art. 2342-2345

Bertolotti, Angelo

Zanichelli, 2023

ISBN 978-88-08-79997-5 | 2024-02-19 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Deine Entscheidung alles, was du über Abtreibung wissen musst

Dornheim, Laura Sophie

Verlag Antje Kunstmann, 2023

ISBN 978-3-95614-536-0 | 2024-02-15 | 11 Soziologie und Kulturwissenschaften

Hauptbibliothek: Freihand, 600/MS 4150 D713 [verfügbar]

Buchcover

Del condominio negli edifici art. 1117-1139

Ciatti Càimi, Alessandro

Zanichelli, 2022

ISBN 978-88-08-42108-1 | 2024-02-20 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Del pagamento con surrogazione art. 1201-1205

Carpino, Benedetto

Zanichelli, 2023

ISBN 978-88-08-52005-0 | 2024-02-19 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Della parentela e dell'affinità art. 74-78

Carbone, Enrico

Zanichelli, 2023

ISBN 978-88-08-89998-9 | 2024-02-19 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Della presunzione di paternità delle prove della filiazione : dell'azione di disconoscimento e delle azioni di contestazione e di reclamo dello stato di figlio : art. 231-249

Ricci, Annarita

Zanichelli, 2022

ISBN 978-88-08-72100-6 | 2024-02-19 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Dem Jesus-Geheimnis auf der Spur

Styria; Bernward bei Don Bosco, 2002

ISBN 978-3-7698-1361-6 | 2024-02-14 | 06 Religion, Theologie

Fachbibliothek Theologie: Freihand, RP 07-520 NEUH [verfügbar]

Buchcover

DenkBAR Materialien zum Theologisieren in Klasse 8-10

Calwer Verlag, 2016

ISBN 978-3-7668-4387-6 | 2024-02-07 | 06 Religion, Theologie


Beschreibung: »DenkBar« bietet eine reichhaltige Auswahl an Texten, Bildern und Unterrichtsimpulsen für die Jahrgangsstufen 8 bis 10, die Schülerinnen und Schülern in einfacher, verständlicher Sprache zentrale Aspekte christlichen Glaubens verdeutlicht und sie zum Nachdenken und Theologisieren herausfordert. Entlang der Inhaltsfelder Gott, Jesus Christus, Mensch und Welt, Kirche, Ethik und Religionen bieten die Kapitel den Schülerinnen und Schülern verschiedene Impulse, um sich mit dem jeweiligen Thema auseinanderzusetzen. Im Vordergrund steht weniger die Vermittlung spezifischer Inhalte, als vielmehr, unterschiedliche Methoden des Theologisierens auszuprobieren und so im eigenen Glauben sprachfähig zu werden, Fragen zu stellen und Stellung zu beziehen.

Fachbibliothek Theologie: Freihand, RP 09-600 HILG [verfügbar]

Buchcover

Der Einfluss des Sechstagekriegs auf das israelisch-iranische Verhältnis und den Antisemitismus im Iran

Artner, Stefan

2023

2024-02-29 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Man findet heutzutage ständig Berichte in den Medien, die über die Rivalität zwischen Israel und dem Iran berichten. Dass in den 1950ern bis in die späten 1970er recht gute Beziehungen zwischen den beiden Staaten vorherrschten, ist heute weitgehend unbekannt. Diese Masterarbeit beschäftigt sich mit dem Zustandekommen der israelisch-iranischen Beziehungen, deren Veränderung durch den Sechstagekrieg und die Veränderung des Umgangs mit Juden im Iran. Dabei wird einerseits die offizielle Perspektive der iranischen Regierung und andererseits die Stimmung im Volk anhand der Texte bedeutender iranischer Intellektueller aufgezeigt. br /Der Autor möchte aufzeigen, dass die iranisch-israelischen Beziehungen zwar offiziell auch nach dem Sechstagekrieg fortgesetzt wurden, aber der Sechstagekrieg sowohl beim Schah als auch bei iranischen Intellektuellen einen Gesinnungswechsel herbeiriefen. Weiter soll gezeigt werden, dass nach dem Sechstagekrieg auch der Antisemitismus einen Aufschwung erhielt.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-133066

Buchcover

Der Einfluss regulatorischer Passung auf die Leistung bei Basketballfreiwürfen

Becker, Jonas Aljoscha

2023

2024-02-29 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Die Theorie des regulatorischen Fokus beschreibt zwei unterschiedliche motivationale Strategien zur Zielerreichung: Den auf Erfolg ausgerichtete Promotion-Fokus und den auf Misserfolgsvermeidung ausgerichtete Prevention-Fokus. Eine Übereinstimmung des regulatorischen Fokus mit dem situativen Fokus einer bestimmten Aufgabe führt zu einer regulatorischen Passung. Es wurde erwartet, dass der positive Effekt regulatorischer Passung bei Amateur-Basketballspielenden (n = 62) zu einer besseren Trefferquote bei Freiwürfen führt. Hierzu warfen die Teilnehmenden sowohl in einem Promotion- als auch einem Prevention-Setting. Wie erwartet trafen Prevention-orientierte im Prevention-Setting sowohl signifikant öfter als Promotion-orientierte, als auch signifikant öfter als sie selbst im Promotion-Setting. Der Effekt der regulatorischen Passung führte also zu einer besseren Leistung der Teilnehmenden.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-142693

Buchcover

Der Gemüsegarten Berlins Bilder einer Ausstellung

Natur und Text, 1996

ISBN 978-3-9803856-7-1 | 2024-02-16 | 43 Land-, Forst- und Hauswirtschaft

Bibliothekszentrum West: Freihand, 800/ZA 80817 M514 [verfügbar]

Buchcover

Der gestörte Bauablauf Praxisleitfaden zur Ermittlung von Mehrkosten und Bauzeitverlängerung

Müller, Katharina

Linde, 2023

ISBN 978-3-7073-3847-8 | 2024-02-13 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Der goldene Käfig des Digitalkapitalismus : nichts kostet mehr als kostenlos

Sühlmann-Faul, Felix

oekom, 2024

ISBN 978-3-98726-079-7 | 2024-02-26 | 24 Informatik


Beschreibung: Die digitale Revolution hat unser Leben tiefgreifend verändert. Unternehmen wie Apple, Google und Meta treiben diese Veränderung voran und steuern zunehmend, wie wir arbeiten und vor allem wie die Wirtschaft funktioniert. Doch hinter den glänzenden Oberflächen der Konzerne, hinter vermeintlichem Erfindungsgeist und kostenlosen Geschenken lauern Gefahren, besonders wenn es um unsere Demokratie, Gesellschaft und unsere Privatsphäre geht. Denn bezahlt wird der Zauber mit unseren persönlichen Daten, die zum Kapital der Zukunft geworden sind. Dieses Buch taucht tief in diese Themen ein, beleuchtet die Herkunft und die Schattenseiten des Digitalkapitalismus. Aber es gibt einen Lichtblick: Der Autor stellt den Priva Score vor - ein smartes Werkzeug, das Datenschutz im digitalen Alltag erleichtert. Damit wird eine einfache Navigation durch den Datenschutzdschungel möglich, die Privatsphäre bleibt geschützt und eigene Daten unter Kontrolle

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 986-Sühl [verfügbar]

Buchcover

Der grüne Faden des Korans eine Lesehilfe

Genç, Mehmet Umut,,

BoD – Books on Demand, 2021

ISBN 978-3-7534-4524-3 | 2024-02-12 | 06 Religion, Theologie

Fachbibliothek Theologie: Freihand, ITR 01-030 GENC [verfügbar]

Buchcover

Der gute Mann Leidegger Roman

Strobel, Bernhard

Literaturverlag Droschl, 2023

ISBN 978-3-99059-140-6 | 2024-02-16 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742799 [verfügbar]

Buchcover

Der König und sein Volk : das Inter-Agieren des johanneischen Jesus vor dem Hintergrund hellenistisch-römischer Herrschermotivik

Mehring, Hanna-Maria

Vandenhoeck & Ruprecht, Dissertation, Universität Augsburg, 2021 - Volltext: https://doi.org/10.13109/9783666500237

ISBN 978-3-525-50023-1 | 2024-03-01 | 06 Religion, Theologie

e-Medien: https://doi.org/10.13109/9783666500237

Buchcover

Der präzise Irrtum : gescheiterte Ideen in den Wissenschaften : fünfundzwanzig Portraits von Forscherinnen und Forschern, die (vermeintlich) Großes geschaffen haben, aber selten in den Schulbüchern anzutreffen sind

Gartmann, Felix,,

Frank & Timme Verlag für wissenschaftliche Literatur, 2024

ISBN 978-3-7329-0997-1 | 2024-02-08 | 25 Naturwissenschaften allgemein

Hauptbibliothek: Magazin HB, 355447 [entlehnt]

Buchcover

Der Susan-Effekt Roman

Høeg, Peter

Hanser, 2015

ISBN 978-3-446-24904-2 | 2024-02-26 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742830 [verfügbar]

Buchcover

Der Tod kommt wie gerufen Roman

Reichs, Kathy,,

Heyne, 2010

ISBN 978-3-453-43462-2 | 2024-02-12 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742776 [verfügbar]

Buchcover

Der Vertriebsingenieur erfolgreich verkaufen - Grundlagen und Regeln für die Praxis

Hüffmann, Peter

VDE Verlag GmbH, 2017

ISBN 978-3-8007-4367-4 | 2024-02-15 | 13 Betriebswirtschaft


Beschreibung: In zunehmendem Maße werden Mitarbeiter im technischen Vertrieb oder im Verkauf erklärungsbedürftiger Leistungen als Schnittstelle zwischen dem Unternehmen und den potentiellen oder akquirierten Kunden eingesetzt. Obwohl viele von ihnen einen ausschließlich technischen Ausbildungsweg oder ein nicht vertriebliches Studium absolviert haben, sollen sie fortan den Absatz der Unternehmen nachhaltig gewährleisten und steigern sowie mit geeigneten Methoden auf Markt- und Umweltbedingungen reagieren können. Andere wiederum werden mit ersten Führungsaufgaben im Vertriebsumfeld betraut und stehen schließlich vor der verantwortungsvollen Aufgabe, Teamumsätze langfristig zu sichern oder zu steigern. (https://www.buchhandel.de)

Fakultaetsbibliothek SoWi: MCI-IV, Maximilianstr. 2, 481-Hüff [verfügbar]

Buchcover

Des Rätsels Lösung - oder warum Kontingenz kein Zufall ist : die determinierte Überraschung und ihre intermediale Wirkungsweise anhand des final plot twist im unzuverlässig erzählten Film

Henning, Kristina.

Schüren, Dissertation, Eberhard Karls Universität Tübingen, 2020 - Volltext: https://d-nb.info/1272894398/04

ISBN 978-3-7410-0428-5 | 2024-02-26 | 48 Film, Rundfunk, Fernsehen

Hauptbibliothek: Freihand, 600/AP 45200 H517 [verfügbar]

Buchcover

Devil bones

Reichs, Kathy,,

Arrow Books, 2009

ISBN 978-0-09-953364-1 | 2024-02-07 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742767 [verfügbar]

Buchcover

Dichte Beschreibung Beiträge zum Verstehen kultureller Systeme

Geertz, Clifford

Suhrkamp, 1987

2024-02-27 | 11 Soziologie und Kulturwissenschaften

Hauptbibliothek: Magazin GEIWI, 610/654 [verfügbar]

Buchcover

Didaktische Gestaltung des Betriebspraktikums für BMHS-Schülerinnen und Schüler in Steuerberatungs- und Wirtschaftsprüfungskanzleien

Triendl, Katja

2023

2024-02-29 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Praktika dienen als wichtiger Baustein in der Berufsbildung und bilden oftmals eine Brücke zwischen beruflicher Ausbildung sowie der Praxisphase. Aus diesem Grund ist es für die optimale Gestaltung besonders wichtig, dass die beteiligten Akteurinnen und Akteure, sprich die Schule, der Betrieb, aber auch die Praktikantinnen und Praktikanten als Team, zusammenarbeiten. Die vorliegende Masterarbeit befasst sich mit der Thematik, wie renommierte Steuerberatungs- und Wirtschaftsprüfungskanzleien in Tirol das Pflichtpraktikum von BMHS-Schülerinnen und -Schüler gestalten. In weiterer Folge werden die jeweiligen Auswahlverfahren innerhalb der Betriebe sowie die Aufgabenverteilung für die jungen Erwachsenen näher unter die Lupe genommen.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-134905

Buchcover

Die 1968er Jahre Utopie und Desillusion in Literatur, Film und Musik

Universitätsverlag Winter, 2023

ISBN 978-3-8253-9554-4 | 2024-02-16 | 15 Allgemeine Sprach- und Literaturwissenschaft

Hauptbibliothek: Magazin HB, 742818 [verfügbar]

Buchcover

Die Beweiskraft der öffentlichen Urkunde

Huger, Ursula

Verlag Österreich, 2023

ISBN 978-3-7046-9331-0 | 2024-02-14 | 08 Recht

e-Medien: https://doi.org/10.33196/9783704693310

Buchcover

Die Filpwarisch Sprooch ein kommentiertes Wörterbuch

Thiel, Josef Franz

Eigenverlag, 2023

ISBN 978-3-200-09364-5 | 2024-02-16 | 17 Germanistik, Skandinavistik, Niederlandistik

Hauptbibliothek: Magazin HB, 388625 [verfügbar]

Buchcover

Die finanzielle Komponente des Urlaubsanspruchs im deutschen und im europäischen Recht Wechsel der Regelungskonzeption ohne Gesetzesänderung?

Friese, Sebastian

Nomos, 2023

ISBN 978-3-7560-1157-5 | 2024-02-22 | 08 Recht

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Die Französische Revolution

Kuhn, Axel,,

Reclam, 1999

ISBN 978-3-15-017017-5 | 2024-02-12 | 54 Geschichte

Hauptbibliothek: Magazin HB, 742795 [verfügbar]

Buchcover

Die Freiheit des Verstehens eine hermeneutisch-kritische Theorie

Bertram, Georg W.

Suhrkamp, 2024

ISBN 978-3-518-30031-2 | 2024-01-29 | 04 Philosophie

Hauptbibliothek: Freihand, 600/CC 3800 B548 [verfügbar]

Buchcover

Die Führungspyramide Leadership - Erkenntnisse, Erfahrungen, Herausforderungen

Michel, Hans Peter

Somedia Buchverlag; Edition Rüegger, 2023

ISBN 978-3-7253-1086-9 | 2024-02-01 | 05 Psychologie

Hauptbibliothek: Magazin HB, 742773 [verfügbar]

Buchcover

Die Gefangenen Roman

Immergut, Debra Jo

Penguin Verlag, 2020

ISBN 978-3-328-60019-0 | 2024-02-26 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742831 [verfügbar]

Buchcover

Die Geschichte der Kunst

Gombrich, Ernst H.

Phaidon, 2010

ISBN 978-0-7148-9137-8 | 2024-02-12 | 45 Kunst

Hauptbibliothek: Magazin HB, 742789 [verfügbar]

Buchcover

Die Geschichte von Uljana

Andruchovy?, Sofija

Residenz Verlag, 2023

ISBN 978-3-7017-1764-4 | 2024-02-16 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742810 [verfügbar]

Buchcover

Die grundbücherliche Sicherung des Erwerbers im Bauträgervertrag

Traxler, Manuel Christian

MANZ'sche Verlags- und Universitätsbuchhandlung, 2023

ISBN 978-3-214-25374-5 | 2024-02-09 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilgerichtliches Verfahren, [verfügbar]

Buchcover

Die Heldenreise einer Führungskraft : wie du als Leader*in die beste Version deiner selbst wirst

Freudiger, Patrick,,

Wiley-VCH GmbH, 2024

ISBN 978-3-527-51127-3 | 2024-02-27 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 365-Freu|b [verfügbar]

Buchcover

Die Herrnhuter Brüdergemeine im 18. und 19. Jahrhundert : Theologie – Geschichte – Wirkung

Vandenhoeck & Ruprecht, 2024

ISBN 978-3-666-56561-8 | 2024-03-01 | 58 Fachlich nicht erfasste Objekte


Beschreibung: Aktuelle Beiträge zur Geschichte und Wirkung der Herrnhuter

e-Medien: https://doi.org/10.13109/9783666565618

Buchcover

Die Kantische Vergeltungstheorie im österreichischen Strafrecht zur Grundausrichtung im materiellen Recht

Werner, Diana

Jan Sramek Verlag KG, 2023

ISBN 978-3-7097-0341-0 | 2024-02-15 | 08 Recht


Beschreibung: Die Monografie geht der Frage nach, welche Übereinstimmungen bzw. Unterschiede es zwischen den von Immanuel Kant entwickelten Strafrechtskonzeptionen in seinem Werk Die Metaphysik der Sitten und dem österreichischen materiellen Strafrecht gibt. Im ersten Teil werden die historischen und gegenwärtigen Entwicklungen der Straftheorien bzw. der Strafzwecke in Österreich behandelt. Dafür werden drei historische Strafgesetze aus dem Habsburgerreich herangezogen und die Strafrechtsreform von 1975 näher beleuchtet. Im zweiten Teil wird die Kantische Vergeltungstheorie auf detaillierter rechtsphilosophischer Basis erläutert. Im dritten Teil, dem Hauptteil der Arbeit, werden sieben Analysen durchgeführt, in welchen Merkmale des Kantischen Vergeltungsprinzips jenen des österreichischen Strafrechts gegenübergestellt und verglichen werden. Dabei werden Themen wie der Verbrechensbegriff, das Wiedervergeltungsrecht, das Terrorismusstrafrecht und das Schuldprinzip erörtert. Im vierten Teil wird in Form eines Fazits die Frage behandelt, welche Aspekte von Kants Strafrechtstheorie als so bedeutend angesehen werden können, dass sie in der Strafrechtsdogmatik bestehen bleiben werden.

Fachbibliothek Recht: Bibliothek für Strafrecht, Strafprozessrecht und Kriminologie, [verfügbar]

Buchcover

Die Kinder von Wien Roman

Neumann, Robert

Jung und Jung, 2023

ISBN 978-3-99027-282-4 | 2024-02-16 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742802 [verfügbar]

Buchcover

Die Kommunikationsstrategien von Papst Franziskus

Löffler, Johannes

Campus, 2024

ISBN 978-3-593-51829-9 | 2024-02-19 | 09 Politik


Beschreibung: Die Macht des modernen Papsttums beruht auf dem gezielten Einsatz zeitgenössischer Mittel öffentlicher Zurschaustellung historisch gewachsener Autorität und persönlichem Charisma. Ob Twitter, YouTube oder Instagram – nicht zuletzt in den digitalen Medien ist es dem Heiligen Stuhl in den vergangenen Jahren gelungen, auch jenseits des Vatikans die Massen zu mobilisieren. Am Beispiel der Amtszeit von Papst Franziskus analysiert Johannes Ludwig Löffler die verbalen und nonverbalen Kommunikationsstrategien des Papsttums zu Beginn des 21. Jahrhunderts. Vom gezielten Einsatz päpstlicher Körpersprache über die Kleidung bis hin zur Wahl der richtigen Worte widmet sich das Buch den multiplen Formen päpstlicher Inszenierung. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 869-Löff [entlehnt]

Buchcover

Die Kunst des strategischen Denkens 6 persönliche Kernkompetenzen für erfolgreiche Strategieentwicklung

Watkins, Michael

Campus Verlag, 2024

ISBN 978-3-593-51909-8 | 2024-02-15 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 313-Watk [verfügbar]

Buchcover

Die LEGO-Story wie der Spielehersteller zur Weltmarke wurde - eine Familiengeschichte

Andersen, Jens

Deutsche Verlags-Anstalt, 2023

ISBN 978-3-421-07004-3 | 2024-02-26 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 324-Ande [verfügbar]

Buchcover

Die Libellen Schleswig-Holsteins

Natur + Text, 2015

ISBN 978-3-942062-19-0 | 2024-02-16 | 29 Zoologie

Bibliothekszentrum West: Freihand, 800/WQ 3750 B889 [verfügbar]

Buchcover

Die Macher hinter den Kulissen wie transatlantische Netzwerke heimlich die Demokratie unterwandern

Ploppa, Hermann

Nomen, 2015

ISBN 978-3-939816-22-5 | 2024-02-02 | 09 Politik


Beschreibung: ''Man kann mehr erreichen, wenn man nicht in der Öffentlichkeit arbeitet.'' (Beate Lindemann, langjährige Geschäftsführerin der Atlantik-Brücke in Berliner Zeitung 16.1.2003) Laut Umfragen wünschen sich die meisten Deutschen eine sozial ausgewogene Politik und eine Außenpolitik unabhängig von den Großmächten in West und Ost. Trotzdem gerät unsere Sozialpolitik in immer bedenklichere Schieflage und wir werden in immer gefährlichere militärische Abenteuer der USA hineingezogen. In letzter Zeit wird allenthalben über TTIP diskutiert. Jedoch nicht über die Initiatoren von TTIP, ihre Motive, ihre ''Philosophie'', ihre Strategie und Taktik. Hermann Ploppa zeigt in diesem Buch die diskreten, feinmaschigen Netzwerke oder auch Seilschaften wie Bilderberger oder Atlantikbrücke, die in aller Stille Politik, Wirtschaft, Medien und Wissenschaft durchdrungen haben. Neoliberale Schockstrategen und US-Lobbygruppen arbeiten seit Jahrzehnten in einem Generationen übergreifenden Projekt an der Enteignung und Entmündigung der Bürger mit dem Ziel der Ersetzung demokratisch legitimierter Nationalstaaten durch die exklusive Herrschaft einer selbst erwählten Elite.''There is no Alternative!'', sagte Maggie Thatcher dereinst. Doch, sagt Hermann Ploppa, und er deutet im Schlusskapitel an konkreten Beispielen Alternativen einer Dreiteilung der Wirtschaft in genossenschaftlich, öffentlich-rechtlich und privatwirtschaftlich-kapitalistisch an. (https://www.buchhandel.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 714-Plop [verfügbar]

Buchcover

Die Macht der Geographie im 21. Jahrhundert : 10 Karten erklären die Politik von heute und die Krisen der Zukunft

Marshall, Tim

dtv, 2023

ISBN 978-3-423-35208-6 | 2024-02-23 | 09 Politik


Beschreibung: Die großen internationalen Konflikte des 21. Jahrhunderts sind heute bereits angelegt. Mit bestechender Klarsicht identifiziert der Politikexperte Tim Marshall, welche zehn Regionen die größten Krisenherde der nahen Zukunft darstellen. Er erklärt, welche Rolle geographische Faktoren spielen, wer in die Konflikte verwickelt ist und welche Lösungen es geben könnte. So wird Australien im Pazifik mit der Supermacht China konfrontiert sein, Griechenland mit der Türkei um Gebiete im Mittelmeer kämpfen, die Sahelzone eine neue Flüchtlingskrise in Europa hervorrufen und der Weltraum unterschiedlichste Besitzansprüche wecken – ein äußerst spannendes Buch, das uns die Augen für die großen Herausforderungen der kommenden Jahre öffnet. (https://www.buchhandel.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 799-Mars|b [verfügbar]

Buchcover

Die Macht der Geschlechternormen und die Grenzen des Menschlichen

Butler, Judith

Suhrkamp, 2012

ISBN 978-3-518-29589-2 | 2024-02-23 | 11 Soziologie und Kulturwissenschaften

Hauptbibliothek: Magazin HB, 742839 [verfügbar]

Buchcover

Die Max-Planck-Gesellschaft Wissenschafts- und Zeitgeschichte 1945–2005

Vandenhoeck & Ruprecht, 2024

ISBN 978-3-666-99364-0 | 2024-02-26 | 54 Geschichte


Beschreibung: Die Max-Planck-Gesellschaft widmet sich in derzeit 86 selbstständigen Instituten der naturwissenschaftlichen, aber auch der sozial- und geisteswissenschaftlichen Grundlagenforschung. Als Einrichtung der nicht-universitären Forschung und Forschungsförderung genießt sie weltweite Anerkennung. Dieser Band stellt ihre Geschichte von der Gründung bis ins erste Jahrzehnt unseres Jahrhunderts umfassend dar, im Ergebnis mehrjähriger Forschungen eines interdisziplinären Forschungsteams. Er behandelt ein zentrales Stück deutscher Wissenschaftsgeschichte in europäischen und globalen Zusammenhängen, auf der Grundlage hier erstmals ausgewerteter Materialien. Zugleich bietet er neue Einsichten in die Gesellschaftsgeschichte der Bundesrepublik.

e-Medien: https://doi.org/10.13109/9783666993640

Buchcover

Die meisten wollen einfach mal reden Strategien gegen Einsamkeit im Alter

Schilling, Elke

Westend, 2024

ISBN 978-3-86489-432-9 | 2024-02-27 | 11 Soziologie und Kulturwissenschaften


Beschreibung: Immer mehr Menschen sind in unserer stark vereinzelten Gesellschaft von Einsamkeit betroffen. Gerade Ältere leiden besonders darunter, denn es ist für sie in der Regel schwierig, sich daraus zu befreien. Zudem schauen viele Menschen beim Thema "Alterseinsamkeit" oftmals lieber weg. Dieses Buch nimmt zum ersten Mal die Einsamkeit der Älteren gezielt in den Fokus. Es versucht, darüber ins Gespräch zu kommen, und zeichnet Lösungen und Wege auf, wie wir der Vereinsamung im Alter individuell und als Gesellschaft entgegenwirken können. Elke Schilling als Gründerin von Silbernetz ist eine ausgewiesene Expertin und zeigt auf, wie wir mit mehr Gemeinsamkeit unsere Gesellschaft stärken können. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 659-Schi|b [verfügbar]

Buchcover

Die neunte Sonne

De Cesco, Federica

Europa-Verl, 2015

ISBN 978-3-95890-009-7 | 2024-02-22 | 17 Germanistik, Skandinavistik, Niederlandistik

Hauptbibliothek: Magazin HB, 742844 [verfügbar]

Buchcover

Die Österreichische Chronik der Jahre 1454-1467 : Edition, Übersetzung, Kommentar

Vandenhoeck & Ruprecht; Böhlau, 2023

ISBN 978-3-205-21857-9 | 2024-03-01 | 54 Geschichte


Beschreibung: Zusammenfassung Die in Wien oder Niederösterreich entstandene ‚Österreichische Chronik der Jahre 1454-1467‘ zeichnet sich durch große Detailgenauigkeit und Lokalkenntnisse aus. Sie bietet einen guten Einblick in die wechselvollen politischen Ereignisse und das Leben in Wien und Umgebung in der zweiten Hälfte des 15. Jahrhunderts. Das Buch enthält erstmals eine alle Handschriften berücksichtigende und modernen wissenschaftlichen Kriterien genügende Edition sowie eine erläuternde Übersetzung, einen textkritischen und einen historischen Apparat.

e-Medien: https://doi.org/10.7767/9783205218579

Buchcover

Die österreichische Strafprozessordnung (Strafprozessordnung 1975) Kurzkommentar : mit den wichtigsten Nebengesetzen

Kirchbacher, Kurt

MANZ'sche Verlags- und Universitätsbuchhandlung, 2024

ISBN 978-3-214-25445-2 | 2024-02-14 | 08 Recht

Fachbibliothek Recht: Bibliothek für Strafrecht, Strafprozessrecht und Kriminologie, [verfügbar]

Buchcover

Die rechte Hand der Architektur baukulturelles Umdenken und pragmatisches Weiterbauen : das Schaffen des Architekten Hubert Meuser 1965–2015

Meyhöfer, Dirk

DOM publishers, 2023

ISBN 978-3-86922-847-1 | 2024-02-05 | 42 Architektur


Beschreibung: Dieser Titel gibt Einblicke in das 50-jährige Schaffen des Architekten Hubert Meuser (geb. 1943), der jeweils als rechte Hand der Kölner Architekten Joachim Schürmann (1926–2022) und Walter von Lom (geb. 1938) für bedeutende Bauten verantwortlich war. Der renommierte Architekturkritiker Dirk Meyhöfer (geb. 1950) legt dabei ein besonderes Augenmerk auf die Frage, wie die Architektenausbildung vor über einem halben Jahrhundert erfolgte, und wie es Hubert Meuser geschafft hat, seine Liebe zum Detail in seinen Arbeiten zum Ausdruck zu bringen. Dabei spannt die Erzählung einen Bogen von den Bleistiftskizzen bis hin zur CAD-Technologie und lässt den Leser tief in den Alltag eines Architekten eintauchen. Kritische Rückblicke erlauben zudem eine Auseinandersetzung mit der deutschen Architekturgeschichte seit den späten Sechzigerjahren. Dieses Buch ist daher nicht nur eine Hommage an einen begeisterten Architekten, sondern spiegelt auch deutsche Zeitgeschichte wider. Meyhöfers Analysen zeigen exemplarisch, wie die Kritik an Flächensanierungen und energetischer Sorglosigkeit zu einem baukulturellen Umdenken führte. Pragmatisches und behutsames Weiterbauen ist in Zeiten von Ressourcenschonung und Zirkularität längst zu einem selbstverständlichen Entwurfsparameter geworden.

Zentraldepot: Externmagazin I, T236617 [verfügbar]

Buchcover

Die Rolle des Europäischen Gerichtshofs im Wandel von judicial activism zu judicial deferencé

Lang, Lea Isabelle.

Nomos, 2023

ISBN 978-3-7560-0791-2 | 2024-02-19 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilgerichtliches Verfahren, [verfügbar]

Buchcover

Die Rolle und Bedeutung der Werbung im Automobil-Marketing

Hutter, Claus

2023

2024-02-29 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Ziel der vorliegenden Dissertation mit dem Titel: „Die Rolle und Bedeutung der Werbung im Automobilmarketing“ ist - unter Verwendung des perspektivischen Ansatzes von Experten aus der Automobilindustrie, dem Autohandel und der Kreativwirtschaft – Betrachtungsweisen von Theorie und Empirie zu vereinen. Dadurch sollen wertvolle, wissenschaftliche Erkenntnisse generiert werden. Der Fokus liegt dabei auf Endkunden in Deutschland, Österreich und Schweiz. Des Weiteren wird im Zuge der Medienkonvergenz, der Digitalisierung und eines veränderten Mediennutzungsverhaltens die Automobilwerbung analysiert: Im Zentrum dieser Betrachtung stehen die Bedeutungsrelevanz im Automobilmarketing, die Verortung von werbepsycho-logischen Erfolgsfaktoren und der Einfluss strategischer Positionierung in Bezug auf den Werbeerfolg.br /br /Die systematische Literaturanalyse stützt sich auf wissenschaftliche Nachbarbereiche der Werbung und auf die Betrachtung komplexer, werblicher Prozesse. Modelle aus interferierenden Fachdisziplinen des Marketings, Konsumentenverhaltens und der Werbepsychologie kommen hier zum Einsatz. Die empirische Untersuchung wird durch die Methode der deskriptiven Statistik von Endkunden und Experten anhand eigener, quantitativen Online-Befragungen durchgeführt und bringt Erkenntnisse sowohl für die Medienwissenschaft als auch die Praxis hervor.br /br /Die Herausforderung in dieser Dissertation besteht darin, die komplexen Interferenzen der Fachdisziplinen im Kontext dieser Arbeit aufzunehmen und in einer Annäherung der Allgemeingültigkeit erfolgsorientiert offenzulegen.br /br /Obwohl Werbung aufgrund der gesellschaftlichen und technischen Transformationen auch künftig einem starken Wandel unterzogen sein wird, ist sie innerhalb des Automobilmarketings immer noch von großer Relevanz.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-130378

Buchcover

Die Schrecklichen Roman

Klemp, Pia

MaroVerlag, Oktober 2023

ISBN 978-3-87512-673-0 | 2024-02-15 | 56 Belletristik und Spielfilme

Hauptbibliothek: Freihand, 600/GO 80000 K64 S37.2023 [verfügbar]

Buchcover

Die Seestadt Aspern : ein Stadtteil im Werden

Dlabaja, Cornelia

Vandenhoeck & Ruprecht; Böhlau, Dissertation, Universität Wien, 2022 - Volltext: https://doi.org/10.7767/9783205219293

ISBN 978-3-205-21928-6 | 2024-03-01 | 11 Soziologie und Kulturwissenschaften


Beschreibung: Städte sind seit jeher Orte, deren Räume und Ressourcen umkämpft sind. Um sie bilden sich Akteurskonstellationen, die Stadträume ausverhandeln und ressourcenabhängig verteilen. Für das vorliegende Buch wurde die Entstehung der Seestadt Aspern, einem neuen Stadtteil in der urbanen Peripherie Wiens, über mehrere Jahre hinweg ethnographisch untersucht. Der Blick liegt dabei auf jenen Rändern und Umbrüchen, die bislang nicht beleuchtet worden sind, wie die Transformation des Umlands und der Verlust der landwirtschaftlichen Betriebe. Dlabaja zeichnet Entscheidungsprozesse nach, untersucht die Ausverhandlung verschiedener Stadtvorstellungen, wie jene der gerechten Stadt, der Smart City, der nachhaltigen und der unternehmerischen Stadt - und beschreibt die Konflikte über die imaginierte Zukunft, die steigende Hitze in der Stadt und die städtische Öffentlichkeit.

e-Medien: https://doi.org/10.7767/9783205219293

Buchcover

Die Sicherung der Werteunion Handlungsoptionen der Europäischen Union zum Schutz der gemeinsamen Werte des Art. 2 EUV.

Hainthaler, Claudia 19XX-

Duncker & Humblot, 2024

ISBN 978-3-428-18957-1 | 2024-02-15 | 08 Recht

Fakultaetsbibliothek SoWi: MCI-I, Universitätsstr. 15, 022-Hain [verfügbar]

Buchcover

Die strafrechtliche Beurteilung des Containerns

Kos, Andreas

2024

2024-02-15 | 58 Fachlich nicht erfasste Objekte

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-145767

Buchcover

Die Tankstelle ein Bautypus im Wandel seiner Symbolhaftigkeit

Arlart, Franz

JOVIS Verlag GmbH, 2023

ISBN 978-3-86859-777-6 | 2024-02-12 | 42 Architektur


Beschreibung: Von frühen modernistischen Designs wie der Typentankstelle von Hans Poelzig, den Reichsautobahn-Normentankstellen der Stuttgarter Schule bis zu Lothar Götz’ modularen Nachkriegstypenbauten als Wegbereiter späterer standardisierter Corporate Designs: Seit den 1920er Jahren prägen Tankstellen unsere Umgebung. Obwohl der Bau von Tankstellen seitdem auch eine relevante Aufgabe für bekannte Architektur- und Ingenieurbüros darstellt, ist der Bautypus bisher kaum ein Thema im Fachdiskurs. Franz Arlart untersucht und systematisiert den Werdegang der Tankstelle in Deutschland aus der Sicht entwerfender Architekt*innen. Unter Berücksichtigung funktionaler, technischer und symbolischer Belange werden die architektonische Entwicklung des Bautypus von 1920 bis 2020 aufgearbeitet und Tendenzen für einen zukünftigen Tankstellenbau skizziert.

Bibliothekszentrum West: Freihand, 800/ZH 6800 A723 [verfügbar]

Buchcover

Die touristische Eroberung der Alpenpässe

Touriseum - Südtiroler Landesmuseum für Tourismus, März 2017

2024-01-30 | 50 Geografie

Hauptbibliothek: Magazin HB, 675710 [verfügbar]

Buchcover

Die Ukraine in Europa : Traum und Trauma einer Nation

wbg Theiss, 2023

ISBN 978-3-8062-4565-3 | 2024-02-08 | 54 Geschichte


Beschreibung: Eingeklemmt zwischen Habsburg und Russland blieb der Ukraine im Lauf der Geschichte meist das Recht auf Selbstbestimmung verwehrt. In Deutschland spielten dabei spätestens seit Russlands Krym-Annexion von 2014 historische Mythen und abenteuerliche Geschichtsauslegungen eine zentrale Rolle. Welch komplexes Geflecht zwischen den Territorien besteht, erkennen Deutschland, der Westen und die NATO erst seit der Katastrophe des Ukraine-Krieges im Zuge der russischen Totalinvasion von 2022. Warum galt die Ukraine vielen so selbstverständlich als Teil der russischen Geschichte, während ihre Verflechtungen mit Polen, Belarus, der Habsburger Monarchie, aber auch Deutschland kaum gesehen wurden? Das neue Buch von Franziska Davies, der Trägerin des Bayerischen Buchpreises 2022 Mit Beiträgen internationaler Historiker:innen und Publizist:innen Historisches Hintergrundwissen zur aktuellen politischen Lage Der fundierte Blick auf die Ukraine jenseits von imperialen Mythen Warum war das Land so lange ein blinder Fleck für Deutschland? Erst jetzt scheinen viele Deutsche die Ukraine neu zu entdecken und stellen erschrocken fest, wie wenig sie über das Land wissen. Franziska Davies liefert einen wichtigen Essayband, der Geschichte und Gegenwart dieser Beziehungen aufzeigt: Die Ukraine als Teil der Habsburger-Monarchie, imperialistische Denkmuster oder schlichte Ignoranz der Ukraine gegenüber, Nationalismus in Russland und in der Ukraine, die Geschichte der Krym, Putins imperiale Visionen, das Verhältnis der Ukraine zu Belarus, zu Polen oder auch die Situation der Frauen in und aus der Ukraine. Versammelt werden mit dem Thema engstens verbundene, hoch engagierte Historiker:innen und Publizist:innen. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 965-Ukra [verfügbar]

Buchcover

Die ungehorsamen Badiotten Wehrdienstentziehung und Fahnenflucht im Zweiten Weltkrieg am Beispiel des Gadertals und des Fersentals

Messner, Michael

April 2023

2024-02-23 | 54 Geschichte

Hauptbibliothek: Magazin HB, 675745 [entlehnt]

Buchcover

Die unreife Republik : zum Zustand Österreichs

Hämmerle, Walter

Leykam, 2023

ISBN 978-3-7011-8307-4 | 2024-02-16 | 09 Politik

Hauptbibliothek: Magazin HB, 355457 [verfügbar]

Buchcover

Die unvollendete Bankenunion

Lederer, Gerald

Verlag Österreich, 2023

ISBN 978-3-7046-9278-8 | 2024-02-14 | 08 Recht

e-Medien: https://doi.org/10.33196/9783704692788

Buchcover

Die Vergabe von Unionsbeihilfen dargestellt am Beispiel der Landwirtschaftssubventionen der Europäischen Union

Jung, Nicolas

Nomos, 2019

ISBN 978-3-8487-5723-7 | 2024-02-14 | 08 Recht

Fachbibliothek Recht: Bibliothek für Völkerrecht, [verfügbar]

Buchcover

Die Weimarer Republik Quellen und Interpretationsvorschläge

Pohl, Karl Heinrich

Wochenschau Verlag, 2024

ISBN 978-3-7344-1601-9 | 2024-02-16 | 54 Geschichte

Hauptbibliothek: Magazin HB, 355461 [verfügbar]

Buchcover

Die Welt im Dorf Wege des Exotischen in die Peripherien des 18. Jahrhunderts

De Gruyter Oldenbourg, 2024

ISBN 978-3-11-078936-2 | 2024-02-13 | 54 Geschichte


Beschreibung: Nicht nur in den großen Handelszentren, auch in der Breite des „Hinterlands konnte man im Zeitalter der Aufklärung dem Fremden und Exotischen begegnen. Die Beiträge des Sammelbandes ergründen systematisch, auf welchen Wegen und in welcher Form Ideen und Wissensbestände aus Übersee in die Dörfer und vermeintlichen Peripherien Europas gelangte und dort weiter zirkulierte. Welche konkreten Medien und Wissensträger waren in der Lage, eine Erfahrung von Globalität im Lokalen zu ermöglichen? Gab es gewisse Erfindungen und Ereignisse, die eine chronologische Entwicklung der Aneignung des Exotischen in der Peripherie erkennbar machen? Erklärtes Ziel des Bandes ist es, die scheinbare Dichotomie von Stadt und Dorf infrage zu stellen und stattdessen die Komplexität der Zirkulation exotischen Wissens aufzufächern. Die Fallbeispiele regen dazu an, sich mit der Geschichte von bislang zu wenig erforschten Orten Europas und ihren globalen Beziehungen zu beschäftigen und über den Ursprung unseres heutigen Verständnisses des Fremden und Exotischen kritisch zu reflektieren.

e-Medien: https://www.degruyter.com/isbn/9783110789256

Buchcover

Die Wertschätzungskette warum wir uns Chefs ohne Empathie nicht leisten können

Korndörffer, Sven H.

Econ, 2024

ISBN 978-3-430-21104-8 | 2024-02-12 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 365-Korn [Transfer]

Buchcover

Die Wirkung von Videospielen auf die psychische Befindlichkeit : der Einfluss von Spieltypus, Alter, Einsamkeit und Geschlecht

Nocker, Elias Augustin

Masterarbeit, Universität Innsbruck, 2023 - Volltext: BibSearch

2024-02-23 | 05 Psychologie


Beschreibung: ger: Ziel dieser Studie war es, die Effekte des Videospielens auf die psychischen Befindlichkeiten Depressivität, Stress, Ängstlichkeit und Einsamkeit zu erforschen. Es wurde vermutet, dass Videospielen einen positiven Effekt auf jene Folgen besitzt. Diese Studie benutzt einen Mixed Methods Ansatz mit N = 209 Teilnehmer*Innen im quantitativen Teil der Arbeit und N = 5 Teilnehmer*Innen im qualitativen Teil. Der Fragebogen bestand aus fünf Teilen: Soziodemografischen Daten, Videospielverhalten, PHQ-9, GAD-7, PSS-10 und der UCLA-LS. Die qualitative Analyse wurde auf Basis eines semi-strukturierten Interviews, mit einem Leitfaden und narrativen Elemente durchgeführt. Es wurde ein signifikanter positiver Zusammenhang zwischen den Singleplayerspielstunden und den Testwerten des UCLA-LS (p = .01, r = .36) gefunden. Frauen wiesen allerdings einen signifikanten positiven Zusammenhang zwischen den wöchentlichen Spielstunden und den Einsamkeits- (p = .01, r = .40) sowie Depressionswerten (p = .03, r = .33) auf. In der Altersgruppe 18-25 wies das Genre Strategie einen negativen signifikanten Zusammenhang zu den Depressions- (p = .01, r = -.31), und Angstwerten (p = .01, r = -.30) auf. Die Ergebnisse der Interviews weisen auf einen positiven Effekt des Videospielens auf das Wohlbefinden hin. Es konnte gezeigt werden, dass die Präferenz für das Genre Strategie mit niedrigeren Depressivitäts- und Angstwerten zusammenhängt. Allerdings zeigen Frauen eine erhöhte Einsamkeit und Depressivität, umso mehr sie spielen und umgekehrt. Dies könnte, wie im qualitativen Teil beschrieben, daran liegen, dass Frauen in Videospielen häufiger mit toxischem Verhalten konfrontiert werden. Die Studie zeigt auf, dass Videospielen einen positiven Effekt auf die untersuchten Konstrukte haben könnte, es jedoch wichtig ist, das Genre, Geschlecht und Alter in ähnlichen Arbeiten zu inkludieren, da diese die Ergebnisse stark beeinflussen.

Hauptbibliothek: Magazin HB, DG67790 [verfügbar]

Buchcover

Die Wirtschaft Volkswirtschaftslehre für eine sich ändernde Welt

The CORE Team

Walter de Gruyter GmbH, 2024

ISBN 978-3-11-129307-3 | 2024-02-15 | 12 Volkswirtschaft


Beschreibung: Das einzige Grundlagenlehrbuch der Volkswirtschaftslehre, in dem die Studierenden die konzeptionellen und quantitativen Instrumente der modernen Volkswirtschaftslehre erlernen, um die drängendsten Probleme der heutigen Zeit in Angriff zu nehmen. Das Buch: • ist ein neuer Ansatz, der die jüngsten Entwicklungen in der Volkswirtschaftslehre einschließlich der Vertragstheorie, der strategischen Interaktion, der Verhaltensökonomie und der finanziellen Instabilität integriert; • fordert die Studierenden heraus, sich mit Ungleichheit, Klimawandel, wirtschaftlicher Instabilität, Vermögensbildung und Innovation sowie weiteren Problemen auseinanderzusetzen; • bietet eine integrierte Behandlung von Mikro- und Makroökonomie; • motiviert alle Modelle und Konzepte durch Fakten und reale Anwendungsfälle. (https://www.buchhandel.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 101-Wirt|e [verfügbar]

Buchcover

Die wunderbare Welt der Vagina und Vulva : Antworten auf all deine Fragen zu Menstruation, Zyklus, Sex und mehr

Dweck, Alyssa

DK, 2021

ISBN 978-3-8310-4171-8 | 2024-02-21 | 34 Medizin und Pflege

Hauptbibliothek: Freihand, 600/WX 5404 D989 [verfügbar]

Buchcover

Die Zeit der Ruhelosen

Tuil, Karine

Ullstein, 2017

ISBN 978-3-550-08175-0 | 2024-02-22 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742845 [verfügbar]

Buchcover

Die Zeremonialwagen der späten Bronzezeit in Europa

Pankau, Claudia,

Verlag Dr Rudolf Habelt GmbH, 2024

ISBN 978-3-7749-4403-9 | 2024-02-13 | 55 Archäologie

Fachbibliothek Altertumswissenschaften: Freihand, 650/NF 2835 P193-1 [verfügbar]

Buchcover

Die zivilrechtliche Behandlung von Insichgeschäften des Stellvertreters

Jira, Sophie Marie Rosalie

2024

2024-02-29 | 58 Fachlich nicht erfasste Objekte

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-146408

Buchcover

Die Zukunft der Skigebiete: das weiße Gold wird grün! story.one - life is a story

Redl, Markus

storyone, 2024

ISBN 978-3-7115-0085-4 | 2024-02-08 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: MCI-III, Weiherburgg. 8, 558-Redl [verfügbar]

Buchcover

Dies ist eine harte Rede schwer verständliche Worte Jesu – erklärt

Bruce, F. F.

VGTG - Verlag für Glaube Theologie & Gemeinde, 2023

ISBN 978-3-902669-41-4 | 2024-02-13 | 06 Religion, Theologie

Fachbibliothek Theologie: Magazin, N-20190 [verfügbar]

Buchcover

Digitale Besuchermessung im Tourismus Ziele, Methoden, Bewertungen

Schmücker, Dirk

UVK Verlag, 2022

ISBN 978-3-7398-3207-4 | 2024-02-28 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: MCI-III, Weiherburgg. 8, 558-Schm|b [verfügbar]

Buchcover

Dinastie di Persia e arte figurativa bibliografia ragionata per un millennio e mezzo di iconografie iraniche

Compareti, Matteo

Paolo Emilio Persiani, 2019

ISBN 978-88-85804-55-5 | 2024-02-07 | 45 Kunst

Zentraldepot: Externmagazin I, X51734 [verfügbar]

Buchcover

Dinosaurier im Reich der Riesenechsen

Baur, Manfred

Tessloff, 2013

ISBN 978-3-7886-2029-5 | 2024-02-23 | 29 Zoologie

Bibliothekszentrum West: Lesesaal, N30717/15 [verfügbar]

Buchcover

Diritti del convivente art. 230 ter

Rossi, Francesco

Zanichelli, 2022

ISBN 978-88-08-72078-8 | 2024-02-19 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Diritto antitrust

Ghezzi, Federico

G Giappichelli, 2023

2024-02-23 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Diritto del lavoro

Magnani, Mariella

Giappichelli, 2023

2024-02-19 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Diritto industriale proprietà intellettuale e concorrenza

G Giappichelli Editore, 2023

ISBN 978-88-921-4468-2 | 2024-02-23 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Diritto internazionale

Ronzitti, Natalino

Giappichelli, 2023

2024-02-16 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Finanzrecht, [verfügbar]

Buchcover

Diritto tributario teoria e tecnica dell'imposizione

Ingrao, Giuseppe

Wolters Kluwer, 2023

ISBN 978-88-13-38341-1 | 2024-02-16 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Finanzrecht, [verfügbar]

Buchcover

Diskurspiraterie als strategische Waffe Ideen linker Theoretiker im ideologischen Kontext der Neuen Rechten

Hager, Dominik

2024

2024-02-15 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Rechtspopulistische und rechtsextreme politische Erscheinungen existieren inzwischen in verschiedenen Ausprägungen und sind seither integraler Bestandteil des gesellschaftlichen Mainstream, und keineswegs mehr am Rande anzusiedeln. Die vorliegende theoretische Masterarbeit wirft dabei einen genauen Blick auf die Neue Rechte bzw. arbeitet systematisch heraus, was denn das Neue im Denken der Neuen Rechten ausmacht. Es wird argumentiert, dass die bisherige Forschungslinie die Rezeption linker Autoren vernachlässigt hat und dass es notwendig ist, das Neue im Denken der Neuen Rechten über ihre Anknüpfungspunkte an die Konservative Revolution hinaus zu erforschen. Wie gezeigt wird, basieren neurechte Ideen zu einem wesentlichen Teil auf genuin linken Schriften und Ausführungen. Diese haben hinsichtlich Ideologie (Ethnopluralismus/Antikapitalismus, wenngleich auch durch Umdeutung) als auch Strategie (Metapolitik) das neurechte Denken entscheidend beeinflusst. Die Arbeit gliedert sich in die Analyse der Ideen von Antonio Gramsci als Grundlage für die 'Kulturrevolution von rechts', gefolgt von der Untersuchung neurechter Autoren in Bezug auf linke Denker und deren Einfluss auf den politischen Diskurs. Dabei wird die strategische Anwendung von 'Diskurspiraterie' als Werkzeug der Neuen Rechten diskutiert, um ihren Einfluss in der Gesellschaft besser verstehen zu können.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-144427

Buchcover

Doors of learning microcosms of a future South Africa

Bauhaus Lab Dessau-Roßlau 2022

Spector Books, 2023

ISBN 978-3-95905-746-2 | 2024-02-05 | 42 Architektur

Zentraldepot: Externmagazin I, T26029 [verfügbar]

Buchcover

Dotterland Roman

Marth, Karoline Therese

Literaturverlag Droschl, 2023

ISBN 978-3-99059-139-0 | 2024-02-16 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742798 [entlehnt]

Buchcover

Dual-energy CT in the detection and quantification of cardiovascular monosodium urate (MSU) deposits

Biermeier, Florian

2023

2024-02-21 | 34 Medizin und Pflege

Hauptbibliothek: Magazin HB, 675735 [verfügbar]

Buchcover

Dynamiken des Scheiterns Akteure, Netzwerke und Transferprozesse der bundesdeutschen Polizeihilfe für Guatemala (1986–1991)

Bennewitz, Fabian

Vandenhoeck & Ruprecht; Böhlau Verlag, 2024

ISBN 978-3-412-52897-3 | 2024-02-27 | 54 Geschichte


Beschreibung: Im Zuge der demokratischen Öffnung Guatemalas begann sich die Bundesrepublik Deutschland ab 1986 mit umfangreichen Ausrüstungslieferungen und Ausbildungsprogrammen an der Reform der berüchtigten Polizei Guatemalas zu beteiligen. Die Ziele dieser sogenannten Polizeihilfe, Professionalisierung und Rechtsstaatsbindung der Polizei, wurden jedoch nicht erreicht und die Kooperation nach Menschenrechtsverletzungen guatemaltekischer Sicherheitskräfte 1991 abgebrochen. Gestützt auf erstmals ausgewertetes Archivmaterial und Interviews analysiert Fabian Bennewitz die Aushandlungsprozesse, die zum Scheitern der Transferbemühungen führten. Indem die Studie den Verlauf der Transfers aus einer transnationalen und relationalen Perspektive rekonstruiert, bietet sie Einblicke in die oft schwer greifbaren Dynamiken entwicklungspolitischer Projekte.In 1986, in the course of Guatemala’s democratic opening, the Federal Republic of Germany launched an extensive police assistance project to help reform the country’s notorious police forces. Equipment deliveries and training programs were intended to move the Guatemalan police forces towards democratic policing principles and rule of law standards. By 1991, however, non of these goals had been achieved. After continuous human rights violations by Guatemala security forces, the cooperation was terminated. Drawing on interviews and new archival sources, Fabian Bennewitz analyzes the negotiation processes that ultimately led to the failure of the project’s transfer efforts. By reconstructing the highly contingent unfolding of the cooperation from a transnational and relational perspective, the author offers insights into the often elusive dynamics of development projects.

e-Medien: https://doi.org/10.7788/9783412528973

Buchcover

Echoes of Gendered Struggle Exploring Gender Dynamics in Autobiographical Accounts of Child Soldiers in Sierra Leone

Ampferer, Nina

2023

2024-02-22 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Diese Masterarbeit untersucht das Phänomen der Kindersoldaten im Bürgerkrieg in Sierra Leone von 1991 bis 2002. Sie konzentriert sich insbesondere auf die Geschlechterdynamik, die in Sierra Leone während dieser Zeit eine wichtige Rolle spielte. Es wird eingehend analysiert, wie geschlechtsspezifische Unterschiede die Rekrutierung, den Einsatz und die Erfahrungen von Kindersoldaten in diesem Konflikt prägten. Um diese geschlechtsspezifischen Merkmale zu untersuchen, werden in diesem Papier drei autobiografische Bücher analysiert: A Long Way Gone von Ishmael Beah, The Bite of the Mango von Mariatu Kamara und Susan McClelland und Rising Heart von Aminata Conteh-Biger und Juliet Rieden.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-143443

Buchcover

Edward, Cole, Kim Weston drei Generationen amerikanischer Fotografie ;

Stemmle Verl Photographie, 1989

ISBN 978-3-7231-0396-8 | 2024-02-06 | 45 Kunst

Hauptbibliothek: Magazin HB, 388611 [verfügbar]

Buchcover

Eiertanz

Spörk, Christof

Seifert Verlag, 2023

ISBN 978-3-904123-82-2 | 2024-02-23 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742855 [verfügbar]

Buchcover

Ein Gott, der Liebe ist die Botschaft der Bibel und die Frage nach Gott

Klaiber, Walter

Vandenhoeck & Ruprecht, 2024

ISBN 978-3-666-50060-2 | 2024-02-29 | 06 Religion, Theologie

e-Medien: https://doi.org/10.13109/9783666500602

Buchcover

Ein Lehrerleben in Vorarlberg Albert Schelling (1918 - 2011)

Schelling, Werner

Eigenverlag, 2023

ISBN 978-3-85298-247-2 | 2024-02-09 | 07 Pädagogik

Hauptbibliothek: Magazin HB, 742793 [verfügbar]

Buchcover

Ein Pfirsich ist ein Apfel mit Teppich drauf systemisch arbeiten im Kindergarten

Orban, Rainer,,

Carl-Auer Verlag GmbH, 2023

ISBN 978-3-8497-0508-4 | 2024-02-26 | 07 Pädagogik

Hauptbibliothek: Freihand, 600/DK 2000 O64(6) [verfügbar]

Buchcover

Ein Streifzug durch die Food History

Kraßnig, Helga

Bookmundo, Dezember 2023

ISBN 978-94-037-2714-1 | 2024-02-05 | 43 Land-, Forst- und Hauswirtschaft

Hauptbibliothek: Magazin HB, 736130/2 [verfügbar]

Buchcover

Eine deutsche Autobiographie

Cixous, Hélène

Passagen Verlag, 2023

ISBN 978-3-7092-0550-1 | 2024-02-16 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 355452 [verfügbar]

Buchcover

Eine göttliche Kunst, Medizin und Krankheit in der Frühen Neuzeit : Katalog zur Ausstellung der Forschungsbibliothek Gotha und des Instituts für die Geschichte der Medizin der Julius-Maximilians-Universität Würzburg vom 14. April bis 23. Juni 2019

Universität Erfurt; Forschungsbibliothek Gotha, 2019

ISBN 978-3-910027-39-8 | 2024-02-16 | 34 Medizin und Pflege

Hauptbibliothek: Sondersammlungen Lesesaal, 388636 [verfügbar]

Buchcover

Eine Theorie von der Wissenschaft des Rechts

Eine Theorie von der Wissenschaft des Rechts München 2022 Veranstaltung

Nomos, 2023

ISBN 978-3-7560-0001-2 | 2024-02-12 | 08 Recht

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Einfach Erstkommunion feiern Erstkommunionvorbereitung unter veränderten Voraussetzungen

Hennecke, Christian

Don Bosco, 2019

ISBN 978-3-7698-1800-0 | 2024-02-14 | 06 Religion, Theologie

Fachbibliothek Theologie: Freihand, RP 07-520 HENN [verfügbar]

Buchcover

Einfluss des relativen Alters und des biologischen Entwicklungsstandes auf die sportmotorische Leistungsfähigkeit bei zehn- bis 14-jährigen Schüler:innen der Sekundarstufe I

Neuner, Carina

2023

2024-02-15 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Einleitungbr /Körperliche Aktivität birgt für Erwachsene sowie Kinder und Jugendliche enorme gesundheitliche Vorteile. Die tatsächliche Zeit, die Kinder und Jugendliche weltweit mit körperlicher Aktivität verbringen, ist jedoch gesunken. Diese Entwicklung spiegelt sich auch in der sportmotorischen Leistungsfähigkeit wider. Relativ ältere Kinder und Jugendliche haben dabei gegenüber ihren relativ jüngeren Kolleg:innen derselben Altersklasse mehr Zeit, sich zu entwickeln, was zu besseren sportmotorischen Leistungen führen kann. Überdies sind Kinder und Jugendliche, die in ihrer biologischen Reife fortgeschritten sind, meist größer und schwerer als Gleichaltrige, die in ihrer biologischen Entwicklung langsamer sind. Das kann für die Anwendung einiger sportmotorischer Fähigkeiten ebenfalls zu Vorteilen führen. Des Weiteren scheint auch die Anzahl an Schulsportstunden ein Einflussfaktor auf die sportmotorische Leistungsfähigkeit von Kindern und Jugendlichen zu sein. Die Studienlage, die alle drei Parameter an österreichischen Kindern und Jugendlichen erhebt, ist jedoch begrenzt. Daher ist es Ziel dieser Masterarbeit, den Einfluss des relativen Alters und des biologischen Entwicklungsstandes auf die sportmotorische Leistungsfähigkeit von zehn- bis 14-jährigen Schüler:innen zu untersuchen und des Weiteren zu berücksichtigen, ob Unterschiede zwischen Normklassen und Sportklassen bestehen.br /Methodikbr /Bei dieser Querschnittserhebung wurde im Zuge des „Klug und Fit“ Projektes mittels fünf sportmotorischer Tests die sportmotorische Leistungsfähigkeit von Schüler:innen der Sekundarstufe I (zehn bis 14 Jahre) untersucht. Dabei wurde aus den fünf motorischen Tests durch z-Transformation ein Gesamtindikator für die sportmotorische Leistungsfähigkeit berechnet, bei dem höhere Werte für eine höhere sportmotorische Leistungsfähigkeit stehen. Das relative Alter wurde in vier Altersquartalen dargestellt. Der aktuelle biologische Entwicklungsstand wurde mit dem Alter zum Zeitpunkt des größten individuellen Wachstumsschubes (APHV) errechnet. Insgesamt konnten Daten von 1.209 (614 Mädchen, 595 Jungen) österreichischen Schüler:innen für die Untersuchung verwendet werden. Die statistische Überprüfung der Hypothesen erfolgte mittels einfaktorieller Varianzanalyse ohne Messwiederholung (ANOVA), Kovarianzanalyse (ANOVA), t-Tests für unabhängige Stichproben und dem Chi²-Test.br /Ergebnissebr /Es zeigte sich, dass hinsichtlich der sportmotorischen Leistungsfähigkeit in Abhängigkeit des relativen Alters signifikante Unterschiede F (3, 1206) = 3.199, p = .023 zwischen den Geburtsquartalen mit geringem Effekt p?² = .008 bestehen. In der durchschnittlichen sportmotorischen Leistungsfähigkeit war zwischen relativ älteren Schüler:innen (Q1 M = .118, SD = .782) und relativ jüngeren Schüler:innen (Q4 M = -.064, SD = .749) ein signifikanter Unterschied zu finden. Hinsichtlich des biologischen Entwicklungsstandes zeigte die ANOVA mit F (2, 1201) = 9.802, p .001, p?² = .016 ein signifikantes Ergebnis mit großem Effekt. Es besteht ein signifikanter Leistungsunterschied von -.271 Standardabweichungen (p .001) zwischen der Gruppe der frühentwickelten (M = -.227, SD = -.796) Schüler:innen und den normalentwickelten (M = .044, SD = .800) beziehungsweise ein signifikanter Unterschied von -.321 Standardabweichungen (p .001) zu den spätentwickelten (M = .094, SD = .808) Schüler:innen. Wenn jedoch die Schulstufe sowie das Körpergewicht als Kovariaten eingesetzt werden, kehrt sich dieser Effekt um und Schüler:innen, die sich früher entwickeln, zeigen bessere sportmotorische Leistungen. Die durchschnittliche sportmotorische Leistungsfähigkeit unterschied sich zudem signifikant (t(521.081) = -17.141, p .001) zwischen Schüler:innen aus Normklassen (M = -.189, SD = .753) und Schüler:innen aus Sportklassen (M = .668, SD = .628).br /Diskussionbr /Die Ergebnisse deuten, trotz meist geringer Effektstärken, an, dass bei zehn- bis 14-jährigen österreichischen Schüler:innen die relativ Älteren eine höhere sportmotorische Leistungsfähigkeit zeigen als ihre relativ jüngeren Kolleg:innen. Zudem weisen biologisch früher entwickelte Schüler:innen eine schwächere sportmotorische Leistungsfähigkeit auf als ihre sich später entwickelnden Kamerad:innen. Wird für die Schulstufe sowie das Körpergewicht kontrolliert, kehrt sich dieser Effekt jedoch um und biologisch früher entwickelnde Schüler:innen weisen eine bessere sportmotorische Leistungsfähigkeit auf. Im Vergleich zwischen Norm- und Sportklassen zeigen Schüler:innen aus Sportklassen überdies eine signifikant bessere sportmotorische Leistungsfähigkeit als Schüler:innen aus Normklassen. Die sportmotorische Leistungsfähigkeit zeigt sich demnach als ein komplexes und vielfältig beeinflussbares Konstrukt, das für die Zukunft ein nach wie vor spannendes und reiches Forschungsfeld bietet.br /Verantwortungspersonen an Schulen sollten sich der Unterschiede in der sportmotorischen Leistungsfähigkeit zwischen relativ jüngeren und relativ älteren Schüler:innen bewusst sein und Maßnahmen gegen eine Bevorzugung oder Unterforderung der relativ älteren Schüler:innen andenken. Zudem bieten die unterschiedlichen Untersuchungsergebnisse zum biologischen Entwicklungsstand Raum für Spekulationen und künftige Forschungen, um angewandte Gleichungen neu zu betrachten.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-142871

Buchcover

Einfluss von Licht- und Wasserversorgung auf das Wachstum und die Hydraulik von Baumsämlingen

Kleiner, Sarah

Masterarbeit, Universität Innsbruck, 2024 - Volltext: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-145475

2024-03-01 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Baumsämlinge sind von zentraler Bedeutung für die Verbreitung von Arten und somit für die Zusammensetzung von Wäldern. Obwohl ein optimierter Wasserhaushalt essentiell für das Überleben und die Etablierung von Sämlingen ist, ist das Wissen darüber bislang allerdings begrenzt. Dabei wären Erkenntnisse wie sich verschiedene Umweltbedingungen auf das Überleben und die Hydraulik von Baumsämlingen auswirken wichtig, um zukünftige Waldzusammensetzung besser einschätzen zu können und um forstwirtschaftliche Maßnahmen zu adaptieren. br /In dieser Arbeit wurden die drei in Tirol heimischen Baumarten Sorbus aucuparia, Pinus cembra und Larix decidua unterschiedlichen Wachstumsbedingungen ausgesetzt und am Ende der ersten Wachstumssaison das Überleben, das Wachstum und die Biomasse, sowie die hydraulische Leitfähigkeit und der Emboliegrad analysiert. Eine Hälfte der Pflanzen wuchs unter vollsonnigen Bedingungen, während bei der anderen Hälfte die Lichtintensität mittels eines Schattierungsgewebes um rund die Hälfte reduziert wurde. Innerhalb des Sonnen- und Schattenbeetes wurden wiederum bei je der Hälfte der Pflanzen der Stamm mit Aluminiumfolie umwickelt, um mögliche Stammphotosynthese zu unterbinden. Im August 2023 wurde schließlich ein Trockenstress induziert, indem in einer Hälfte der Beete die Bewässerung so lange ausgesetzt wurde, bis ca. 10% Leitfähigkeitsverlust zu erwarten war. Nach dem Trockenstress wurden die Baumsämlinge wiederbewässert. Von Juli bis September 2023 wurde in wöchentlichen Abständen die Pflanzen auf ihre Vitalität überprüft. Im September 2023 wurden an je vier Individuen pro Art und Wachstumsbedingung die hydraulische Leitfähigkeit mittels µ-Flowmeter gemessen und der Emboliegrad bestimmt. Anschließend wurde jede Pflanze in Wurzeln, Blätter, Stamm und Rinde aufgeteilt und mit Hilfe des jeweiligen Trockengewichtes die Biomasse bestimmt. Zudem wurden an allen verbliebenden Sämlingen die Pflanzenhöhe sowie der Stammdurchmesser bestimmt. br /Die Ergebnisse zeigten lediglich geringe Auswirkungen von Licht und Wasserversorgung, sowie Verhinderung von Stammphotosynthese auf das Überleben, das Wachstum, die Biomasse und die Hydraulik, wobei es aber artspezifische Unterschiede gab. Die geringere Lichtintensität im Schattenbeet wirkte sich insgesamt positiv auf die Überlebensrate, das Wachstum und die Biomasse aus. Während die Unterschiede zwischen Sonnen- und Schattenpflanzen bei Sorbus allerdings minimal waren, gab es bei Larix deutliche Unterschiede. Die Leitfähigkeit und der Emboliegrad wurden bei keiner Art wesentlich von den unterschiedlichen Lichtbedingungen beeinflusst. Die Stammabdeckung wirkte sich positiv auf das Überleben von Pinus aus, führte aber ebenso wie der induzierte Trockenstress zu keinen eindeutigen Veränderungen in der hydraulischen Effizienz oder Emboliegrad. br /Es ist anzunehmen, dass der Trockenstress in seiner Dauer und Intensität nicht ausreichte, eindeutige Auswirkungen auf die Hydraulik und das Wachstum der Baumsämlinge zu verursachen. Weitergehende Untersuchungen hierzu wären daher notwendig, um die Mechanismen und Auswirkungen von Trockenstress bei Baumsämlingen besser verstehen zu können. Zudem wären neue Erkenntnisse dazu auch in der angewandten Forschung wichtig, um beispielsweise durch gezielte forstwirtschaftliche Maßnahmen zukunftsfähige Wälder zu gestalten.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-145475

Buchcover

Einführung in das niederösterreichische Bau- und Raumordnungsrecht

Wirrer, Michael

Linde, 2023

ISBN 978-3-7073-4882-8 | 2024-02-19 | 08 Recht

Fachbibliothek Recht: Bibliothek für Öffentliches Recht, Staats- und Verwaltungslehre, [verfügbar]

Buchcover

Einführung in das Steiermärkische Bau- und Raumplanungsrecht praxisbezogene Gesamtdarstellung : die wichtigsten baurechtlichen Begriffe im Überblick : aktuelle Gesetzestexte : OIB-Richtlinien

Eisenberger, Georg

Linde, 2023

ISBN 978-3-7073-3821-8 | 2024-02-19 | 08 Recht

Fachbibliothek Recht: Bibliothek für Öffentliches Recht, Staats- und Verwaltungslehre, [verfügbar]

Buchcover

Einführung in das Tiroler Bau- und Raumordnungsrecht

Bußjäger, Peter

Linde, 2024

ISBN 978-3-7073-4820-0 | 2024-02-14 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Einführung in die Gute Laborpraxis ein praxisorientiertes Handbuch

Fleischhauer, Ilona

Wiley-VCH, 2023

ISBN 978-3-527-34803-9 | 2024-02-05 | 25 Naturwissenschaften allgemein


Beschreibung: Bietet einen Praxisnahmen und strukturierten Überblick über das Thema GLP; für den erfahrenen GLP/QM-Mitarbeiter bietet es antworten auf Fragen, die die Umsetzung der GLP-Grundsätze im Laboralltag betreffen.

Bibliothekszentrum West: Freihand, 800/VC 5100 F596 [verfügbar]

Buchcover

Einführung in die Problematik des Vulgärlateins

Kiesler, Reinhard

De Gruyter, 2018

ISBN 978-3-11-054636-1 | 2024-03-01 | 18 Romanistik


Beschreibung: Welche Entwicklungen haben zur Herausbildung der romanischen Sprachen geführt? Da die Geschichte des Lateinisch-Romanischen über 2500 Jahre belegt ist, verfügt die historische Linguistik hier über verlässliches Material, um diese Frage zu beantworten. Als erste deutschsprachige Einführung ins Vulgärlatein seit einem halben Jahrhundert dokumentiert das aktualisierte und erweiterte Arbeitsheft den phonologischen, morphosyntaktischen und lexikalen Wandel, der den sermo vulgaris kennzeichnet, bis hin zur Fragen des griechischen Einflusses und der Typologie. Mit einführenden Kapiteln zu Definition, Forschungslage, externer Sprachgeschichte und Quellen des Vulgärlateins, einer Übersicht lateinischer Verbformen sowie einer kommentierten Auswahl von Texten wird dieses Buch zu einem besonders hilfreichen Begleiter im Studium

e-Medien: https://doi.org/10.1515/9783110546361

Buchcover

Einsichten, Aussichten das Salzkammergut zwischen Faktischem und Anekdotischem

mandelbaum verlag, 2023

ISBN 978-3-99136-041-4 | 2024-02-15 | 54 Geschichte

Hauptbibliothek: Freihand, 600/NR 8282 B819 [verfügbar]

Buchcover

Eisbären geliebt und verraten

Jørgensen, Morten

Natur+Text GmbH, Juni 2023

ISBN 978-87-973965-2-0 | 2024-02-12 | 29 Zoologie

Bibliothekszentrum West: Freihand, 800/WS 6400 J64 [verfügbar]

Buchcover

Eisenbahn auf Schienen in die Zukunft

Tessloff, 2015

ISBN 978-3-7886-2079-0 | 2024-02-26 | 44 Verkehr und Mobilität

Bibliothekszentrum West: Lesesaal, N30717/54 [verfügbar]

Buchcover

Eisgrab ein Grönland-Thriller

Nordbo, Mads Peder

Fischer Taschenbuch, 2019

ISBN 978-3-596-70173-5 | 2024-02-26 | 56 Belletristik und Spielfilme


Beschreibung: Als Biochemiker führte der Vater des Journalisten Matthew Cave vor 25 Jahren auf der US-Militärbasis in Thule/Grönland missglückte Kälteexperimente durch und hat den Tod mehrerer Versuchspersonen zu verantworten. Seither ist er in Grönland untergetaucht und verschwunden. Als Matthew wegen einiger rätselhafter, blutiger Morde in Grönland recherchiert (vgl. Eisrot)kommt er jedoch noch einer ganz anderen Sache auf die Spur: Seine Halbschwester ist spurlos verschwunden und befindet sich offenbar in Lebensgefahr: Bald muss sich Matthew mit einer gefährlichen Mischung aus Gewalt, Inuitritualen, US-Militär und grönländischer Polizei herumschlagen und alles überdenken, was er über seinen Vater zu wissen glaubte ... - KomplexeHandlungsstränge, viele handelnde Personen, vielschichtige Zusammenhänge - dem Autor ist ein packender und atmosphärischer Thriller gelungen, bei dem vor allem die Fans von Schnee, Eis, Kälte und natürlich von Grönland auf ihre Kosten kommen. Auch wenn die Story nicht immer schlüssig ist, die unwirtliche Atmosphäre reisst's raus. Allen Beständen empfohlen

Hauptbibliothek: Magazin HB, 742827 [verfügbar]

Buchcover

Eiskalter Wahnsinn Roman

Kava, Alex

Cora Verl, 2003

ISBN 978-3-89941-091-4 | 2024-02-14 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742766 [verfügbar]

Buchcover

Electoral authoritarianism the dynamics of unfree competition

Lynne Rienner Publishers, 2006

ISBN 978-1-58826-415-2 | 2024-02-20 | 09 Politik

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 739-Elec|c [entlehnt]

Buchcover

Elefanten die grauen Riesen

Weller-Essers, Andrea

Tessloff, 2017

ISBN 978-3-7886-2107-0 | 2024-02-26 | 29 Zoologie

Bibliothekszentrum West: Lesesaal, N30717/86 [verfügbar]

Buchcover

Elektrizität Megavolt und Supraleiter

Hennemann, Laura

Tessloff, 2013

ISBN 978-3-7886-2051-6 | 2024-02-23 | 07 Pädagogik

Bibliothekszentrum West: Lesesaal, N30717/24 [verfügbar]

Buchcover

Elementar! Bausteine der Chemie

Baur, Manfred

TESSLOFF, 2022

ISBN 978-3-7886-7697-1 | 2024-02-22 | 30 Chemie

Bibliothekszentrum West: Lesesaal, N30720 [verfügbar]

Buchcover

Elementare Bibeltexte subjektorientiert - biblisch-theologisch - didaktisch

Vandenhoeck & Ruprecht, 2024

ISBN 978-3-666-61427-9 | 2024-02-29 | 06 Religion, Theologie

e-Medien: https://doi.org/10.13109/9783666614279

Buchcover

Elon Musk die Biografie

Isaacson, Walter

C Bertelsmann, 2023

ISBN 978-3-570-10484-2 | 2024-02-16 | 54 Geschichte

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 324-Isaa|b [verfügbar]

Buchcover

Emanzipation nach der Emanzipation jüdische Literatur, Philosophie und Geschichte um 1900

V&R unipress Vienna University Press, 2024

ISBN 978-3-7370-1679-7 | 2024-02-28 | 06 Religion, Theologie

e-Medien: https://doi.org/10.14220/9783737016797

Buchcover

Emmie Arbel - die Farbe der Erinnerung

Yelin, Barbara

REPRODUKT, November 2023

ISBN 978-3-95640-396-5 | 2024-02-15 | 54 Geschichte

Hauptbibliothek: Freihand, 600/NY 9250 A664 Y4 [verfügbar]

Buchcover

Empowering the Dalits and poor in the power of the spirit

Alangaram, A.,,

ATC Publishers, January 2019

ISBN 978-93-88968-06-5 | 2024-01-25 | 06 Religion, Theologie

Fachbibliothek Theologie: Magazin, N-19887 [entlehnt]

Buchcover

EMRK Europäische Menschenrechtskonvention

Helbing & Lichtenhahn; Manz; Nomos, 2023

ISBN 978-3-214-25127-7 | 2024-02-22 | 08 Recht

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Entrepreneurship

Ignatianum University Press, 2022

ISBN 978-83-7614-551-8 | 2024-02-09 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 314-Entr|b [verfügbar]

Buchcover

Entwicklungslinien und Entwicklungsperspektiven im Mobiliarsicherungsrecht

Faber, Wolfgang

Jan Sramek Verlag, 2023

ISBN 978-3-7097-0329-8 | 2024-02-14 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Entziehung der persönlichen Freiheit aus medizinischen Gründen eine Untersuchung verfassungs- und verwaltungsrechtlicher Grundlagen

Riederer, Maria-Theresa

Jan Sramek Verlag, 2023

ISBN 978-3-7097-0330-4 | 2024-02-15 | 08 Recht

Fachbibliothek Recht: Bibliothek für Strafrecht, Strafprozessrecht und Kriminologie, [verfügbar]

Buchcover

Erbschuld Roman

Sewell, Kitty

Buchgemeinschaft Donauland ua; RM-Buch-und-Medien-Vertrieb, 2009

2024-02-20 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742803 [verfügbar]

Buchcover

Erlanger Jahrbuch für Interreligiöse Diskurse

Nomos, 2024

ISBN 978-3-98740-109-1 | 2024-02-26 | 06 Religion, Theologie

e-Medien: https://doi.org/10.5771/9783987401091

Buchcover

EU collective labour law

Edward Elgar Publishing, 2021

ISBN 978-1-78811-638-1 | 2024-02-16 | 58 Fachlich nicht erfasste Objekte

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

EU regulation on succession and wills commentary

Bergquist, Ulf

O Schmidt, 2015

ISBN 978-3-504-08001-3 | 2024-02-14 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Europäische Grundrechte und Grundfreiheiten

De Gruyter, 2023

ISBN 978-3-11-071673-3 | 2024-02-20 | 08 Recht

Fachbibliothek Recht: Bibliothek für Europarecht, [verfügbar]

Buchcover

Europas imaginierte Einheit Kulturgeschichte und Antikerezeption bei Stefan Zweig

Nebelin, Marian

Böhlau, 2024

ISBN 978-3-412-52325-1 | 2024-02-12 | 54 Geschichte

Fachbibliothek Theologie: Freihand, 202-Pm NEBE [verfügbar]

Buchcover

Evaluierung zum Förderprogramm "Resiliente Kinder“, einem Konzept zur frühen Förderung von Resilienz in Kindergarten und Volksschule

Gölles, Isabella Berivan

Masterarbeit, Universität Innsbruck, 2023 - Volltext: BibSearch

2024-02-23 | 05 Psychologie


Beschreibung: ger: Die Covid-19 Pandemie hat negative psychische Spuren, gerade bei der vulnerabelsten Gruppe unserer Gesellschaft - den Kindern - hinterlassen. Schon vor der Covid-19 Pandemie hat ein Paradigmenwandel von der Pathogenese hin zur Salutogenese und präventiven Maßnahmen stattgefunden. Gerade in Krisenzeiten ist es wichtig die Kinder bei der Entwicklung und Entfaltung von resilienzbezogenen Fähigkeiten zu unterstützten. Aus der Resilienzforschung ist bekannt, dass mit Programmen zur frühen Förderung von Resilienz -der psychischen Widerstandskraft- gute Ergebnisse erzielt werden können. Es wird eine empirische Arbeit zum Förderprogramm „Resiliente Kinder“ durchgeführt. Kinder im Alter von drei bis sechs Jahren wurden in einem Prä-Post-Design, mit dem ins Deutsche übersetzten Second-Step-Interview, einem Erhebungsinstrument zu sozial-emotionalen Fähigkeiten, befragt. Weitere resilienzbezogene Daten zu den Kindern wurden über die betreuenden Pädagoginnen mithilfe einer Fragebogenbatterie (Woerner et al., 2002; Schick 2003) erhoben. Die Fragebogenbatterie enthielt den Fragebogen zu Stärken und Schwächen von Kindern (SDQ-Deu), einen Teil (Items zu sozialen Kompetenzen) der Kompetenz-Angst-Aggressions-Liste (KAAL) und erhob soziodemographische Daten. Die Gesamtstichprobe umfasst N=120 (n=52 Mädchen, n=68 Jungen) Kinder. Die Teilstichprobe der Mittels der Befragungen durch die Pädagoginnen erhobenen Daten zu den Kindern umfasst n =95 im Alter von drei bis sechs Jahren (M=5,22; SD=.829) Die Teilstichprobe der direkt befragten Kinder beträgt n=85 im Alter von drei bis sechs Jahren. Es wurden deutliche Indizien beobachtet, die die positive Wirkung des Förderprogramms „Resiliente Kinder“ in dieser Evaluationsstudie im Prä-Post-Design vermuten lassen. Mithilfe einer 2-faktoriellen Varianzanalyse bei Messwiederholung wurden die Gesamtskalen des SDQ-Deu (Emotionale Probleme, Verhaltensaufälligkeiten, Hyperaktivität, Peer- Probleme, Prosoziales Verhalten), der KAAL-Liste (Soziale Kompetenz) und des Second-Step-Interview (Gefühle erkennen, Nutzung von Hinweisen zur Gefühlserkennung, Brainstorming nach alternativen Lösungen, soziale Strategien zur Gruppenteilnahme, Vorhersage von Konsequenzen zur Gruppenteilnahme, Fähigkeiten zu alternativen Lösungen, Beruhigungstechniken) berechnet. Alle drei Haupthypothesen erwiesen sich als signifikant (p.05). Die Ergebnisse lassen darauf schließen, dass resilienzbezogene, sozial-emotionale Fähigkeiten gezielt gefördert werden können. Besonders in pandemischen Zeiten, die die Risikobelastung bei Kindern massiv erhöhen, sind diese resilienzbezogene Fähigkeiten von entscheidender Wichtigkeit. Als präventive Maßnahme sollen Resilienzfähigkeiten im frühen Kindesalter, da dieser Lebensabschnitt sich am besten dafür eignet (Wright et al, 2013), im Allgemeinen und speziell während Krisenzeiten, wenn möglich institutionell gefördert werden.

Hauptbibliothek: Magazin HB, 675747 [verfügbar]

Buchcover

Exploratory analysis of collective forecasts about company future events using Twitter

Leibhammer, Adriane Alina

2024

2024-02-29 | 58 Fachlich nicht erfasste Objekte


Beschreibung: eng: With the increase in online communications and the improvements in technology, leveraging the value of big data becomes more important. Recent developments in natural language processing (NLP) show strong improvements in extracting meaning by considering time expressions. Analyzing social media data, this thesis aims to extract a future collective image of perceptions of company events using Twitter (X). The dataset used consists of almost three million tweets referencing five big companies in the years 2015 to 2020. Tweets are classified and clustered. Focusing on Tesla, public reporting data as combined with social media data in the clustering process to extract clusters that are specifically not emerging from trends already published. Three main clusters were identified. Comparing those clusters with what actually happened, the clusters refer in keywords and in timing strongly to the actual events.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-146869

Buchcover

Exzellente Lehre im juristischen Studium auf dem Weg zu einer rechtswissenschaftlichen Fachdidaktik

Nomos, 2011

ISBN 978-3-8329-6385-9 | 2024-02-12 | 08 Recht


Beschreibung: Die Qualität der akademischen Lehre ist in die hochschulpolitische Diskussion geraten. Daher widmet sich auch die Rechtswissenschaft verstärkt der Frage nach guter Lehre im juristischen Studium. Der erste Band der Schriften zur rechtswissenschaftlichen Didaktik enthält eine Bestandsaufnahme und kritische Reflexion bisheriger Zugänge, Projekte und Rahmenbedingungen zur Verbesserung der juristischen Ausbildung und Lehre. Damit schafft er die Grundlage für einen qualifizierten Austausch über die Art und Weise des Lehrens und Lernens in der Rechtswissenschaft.

Fachbibliothek Recht: Fachbibliothek Recht, M 150 [verfügbar]

Buchcover

Fachkräfte für die Daseinsvorsorge heute hier, morgen weg?

Nomos, 2024

ISBN 978-3-7489-3968-9 | 2024-02-14 | 11 Soziologie und Kulturwissenschaften

e-Medien: https://doi.org/10.5771/9783748939689

Buchcover

Fachtagung Personenschaden 2023

Fachtagung Personenschaden Berlin 2023

Nomos, 2023

ISBN 978-3-7560-0789-9 | 2024-02-19 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Fallbuch Bank- und Versicherungsrecht

Vonkilch, Isabelle

MANZ'sche Verlags- und Universitätsbuchhandlung, 2024

ISBN 978-3-214-25452-0 | 2024-02-14 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Falsche Mehltaue, Rostpilze Brandpilze

Jage, Horst

Natur + Text, 2020

ISBN 978-3-942062-46-6 | 2024-02-08 | 27 Biologie allgemein

Bibliothekszentrum West: Freihand, 800/WF 9500 F828-1 [verfügbar]

Buchcover

Familienrecht in der Sozialen Arbeit

Benner, Susanne A.

transcript, 2024

ISBN 978-3-8252-6237-2 | 2024-02-09 | 07 Pädagogik


Beschreibung: Das Familienrecht ist ein grundlegender Bestandteil in der Sozialen Arbeit. Susanne A. Benner führt in die Materie ein und vermittelt sodann ein umfassendes Verständnis für den Zusammenhang von Recht und Sozialer Arbeit. Strukturiert behandelt sie familienrechtliche Fragestellungen einschließlich des familienrechtlichen Verfahrens und bezieht dabei auch angrenzende Rechtsgebiete wie z. B. das Kinderund Jugendhilferecht ein. Fallbeispiele aus der Praxis bereichern die Theorie, darüber hinaus sorgen Fragen und Lösungshinweise für ein angeleitetes Selbststudium. Ein Stichwortverzeichnis sowie ein Glossar zur schnellen Recherche juristischer Termini runden das Werk ab - und machen es für Studierende der Sozialen Arbeit zu einer Leitlinie für den Umgang mit der Komplexität des Familienrechts im Arbeitsalltag

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 591-Benn [verfügbar]

Buchcover

Fantascienza femminista : immaginare il genere nella cultura italiana contemporanea

Franco Cesati Editore, 2022

ISBN 978-88-7667-970-4 | 2024-02-15 | 18 Romanistik

Hauptbibliothek: Freihand, 600/IV 3376 O55 [verfügbar]

Buchcover

Farne Vielfalt und Geschichte einer der ältesten Pflanzengruppen

Sundin, Anton ca. 20. Jh.

Haupt Verlag, 2023

ISBN 978-3-258-08272-1 | 2024-02-06 | 28 Botanik

Bibliothekszentrum West: Freihand, 800/WL 7325 S958 [verfügbar]

Buchcover

Feedback für den Lehralltag Lehren und Lernen im Dialog

Auferkorte-Michaelis, Nicole

UTB; Barbara Budrich, 2023

ISBN 978-3-8385-6131-8 | 2024-02-15 | 07 Pädagogik

e-Medien: https://doi.org/10.36198/9783838561318

Buchcover

Fehlerfalltür in der gläsernen Decké : wie sich das Begehen eines Fehlers auf die Bewertung von Frauen in männlich dominierten Berufen auswirkt

Jud, Stephanie

Masterarbeit, Universität Innsbruck, 2023 - Volltext: BibSearch

2024-02-23 | 05 Psychologie


Beschreibung: ger: Aufgrund ihres Genders werden Personen unterschiedlich bewertet und behandelt. In der Arbeitswelt werden vor allem erfolgreiche Frauen in männlich dominierten Berufen negativ wahrgenommen. Im Vergleich zu ihren männlichen Kollegen werden sie zwar als ähnlich kompetent, zugleich aber auch als weniger sympathisch bewertet und häufiger sabotiert. Die Überzeugung, dass Frauen nicht diskriminiert werden, verstärkt diese negativen Reaktionen. Das Ziel der vorliegenden Studie war es, zu untersuchen, inwiefern sich die negative Bewertung einer erfolgreichen Frau in einem männlich dominierten Beruf ändert, wenn sie einen Fehler begeht und ob diese Einstellung auch nach einer Rehabilitierung bestehen bleibt. Angenommen wurde, dass die Frau nach einem Fehler als weniger kompetent, zugleich aber auch als sympathischer bewertet werden würde als ein vergleichbarer Mann. Diese Bewertung sollte auch nach einer Rehabilitierung aufgrund des Perseveranzeffekts bestehen bleiben. Die Verhaltenstendenz gegenüber der Frau sollte zudem immer negativer ausfallen als gegenüber dem Mann. Im Unterschied zum männlich dominierten Beruf wurde in einem weiblich dominierten Beruf davon ausgegangen, dass sich die Bewertungen zwischen einem erfolgreichen Mann und einer erfolgreichen Frau nicht unterscheiden. Um dies zu untersuchen, bekamen 248 Proband*innen, welche größtenteils Studierende waren, nacheinander drei fiktive Zeitungsabschnitte über einen Mann oder eine Frau in einem männlich oder weiblich dominierten Beruf zu lesen. Im ersten Abschnitt wurde die Person vorgestellt, im zweiten beging sie einen Fehler und im dritten Abschnitt wurde sie rehabilitiert. Nach jedem Artikelabschnitt bewerteten die Proband*innen die Kompetenz, die Sympathie und die Verhaltenstendenz gegenüber der Person aus dem Artikel. Zum Schluss wurde der moderne Sexismus der Proband*innen erhoben. Die statistische Analyse ergab, dass Frauen insgesamt und speziell in der männlich dominierten Berufsbedingung positiver bewertet wurden als Männer. Zudem erhielten sie höhere Sympathiebewertungen und positivere Verhaltenstendenzen. Der moderne Sexismus hatte keinen Einfluss auf die Bewertungen. Die Effekte waren klein und widersprachen den Hypothesen. Grund dafür war möglicherweise ein sozialer Erwünschtheitseffekt, Shifting Standards bei der Bewertung, eine internale Motivation, nicht sexistisch zu erscheinen, sowie soziodemographische Merkmale der Stichprobe. Die vorliegende Studie konnte die Forschungsfrage nicht beantworten. Zukünftige Forschung sollte die genannten Einflussfaktoren berücksichtigen.

Hauptbibliothek: Magazin HB, DG67792 [verfügbar]

Buchcover

Festschrift für Franz Merli

Manz; Nomos, 2023

ISBN 978-3-214-00792-8 | 2024-02-27 | 08 Recht

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Fethanei : l'approdo perduto : romanzo storico

Beati, Alessandro

Amazon Italia Logistica Srl, settembre 2023

2024-02-15 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 653613 [verfügbar]

Buchcover

Fichten-Land wie Deutschland seine Wälder verlor

Panek, Norbert

Natur+Text, 2021

ISBN 978-3-942062-53-4 | 2024-02-06 | 28 Botanik

Bibliothekszentrum West: Freihand, 800/ZC 74070 P191 [verfügbar]

Buchcover

Finanzstrafrecht

Glaser, Severin

MANZ'sche Verlags- und Universitätsbuchhandlung, 2024

ISBN 978-3-214-25528-2 | 2024-02-22 | 08 Recht

Fachbibliothek Recht: Bibliothek für Strafrecht, Strafprozessrecht und Kriminologie, [verfügbar]

Buchcover

Fine dying ein Mira-Valensky-Krimi

Rossmann, Eva

Folio Verlag, 2023

ISBN 978-3-85256-887-4 | 2024-02-16 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742800 [verfügbar]

Buchcover

Finite element analysis of shear failure in sand using micropolar hypoplasticity

Basche, Konstantin Viktor

2024

2024-02-29 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Das Versagen granularer Böden wird häufig durch eine Scherbelastung hervorgerufen. Dieser Zustand ist oft durch die Bildung von Scherbändern gekennzeichnet, in denen die Verformungen lokalisiert sind. Zur Vorhersage des mechanischen Verhaltens von geotechnischen Strukturen ist es essenziell, dieses Verhalten in numerischen Simulationen präzise abzubilden.br /Das Ziel dieser Arbeit ist es, die Fähigkeit eines mikropolaren hypoplastischen Materialmodells zur Vorhersage des Scherversagens von Sand mittels Finite-Elemente-Analyse kritisch zu bewerten. Es wird das von Maier (2002) eingeführte mikropolare hypoplastische Modell betrachtet, welches auf dem etablierten hypoplastischen Materialmodell von Wolffersdorff (1996) basiert. Unter Verwendung von sowohl 2D- als auch 3D-Finite-Elemente-Simulationen wird das mechanische Verhalten von Sandproben in Standard-Laborversuchen, wie dem Biaxial- und dem Triaxialversuch modelliert. Es wird gezeigt, dass das mikropolare hypoplastische Modell das nichtlineare, inelastische Verhalten von Sand unter Berücksichtigung der Dichte- und Druckabhängigkeit gut wiedergibt.br /Eine Netzstudie bestätigt, dass das Modell auch in der Lage ist, Spannungs- und Deformationszustände bei scherdominiertem Versagen netzunabhängig vorherzusagen. Im Vergleich zu einem klassischen hypoplastischen Modell, das die inhärente körnige Mikrostruktur vernachlässigt, zeigen unsere Ergebnisse die Vorteile des mikropolaren hypoplastischen Modells in Bezug auf die Netzempfindlichkeit im Versagensbereich. Zusätzlich wird der Einfluss von mikropolaren Materialparametern wie dem mittleren Korndurchmesser und der Kornrauhigkeit auf das Materialverhalten und die Scherbandeigenschaften untersucht. Abschließend werden die numerischen Ergebnisse dieser Studie mit experimentellen Labortestdaten verglichen, was die Validität des Modells bestätigt. Weitere Untersuchungen zum Einfluss von strukturellen Inhomogenitäten und die Anwendung des Modells auf reale geotechnische Strukturen sind für die Zukunft geplant.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-145179

Buchcover

Fische Wunderwelt im Wasser

Schirawski, Nicolai

Tessloff, 2014

ISBN 978-3-7886-2076-9 | 2024-02-19 | 29 Zoologie

Bibliothekszentrum West: Lesesaal, N30717/41 [verfügbar]

Buchcover

Fleisch Roman

Kava, Alex

Mira, 2012

ISBN 978-3-86278-347-2 | 2024-02-08 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742734 [verfügbar]

Buchcover

Flexibility in Resource Management

Imprint Springer; Springer Singapore, 2018

ISBN 978-981-10-4888-3 | 2024-02-20 | 58 Fachlich nicht erfasste Objekte

e-Medien: BibSearch

Buchcover

FlexKapGG : Flexible-Kapitalgesellschafts-Gesetz : Kurzkommentar

Eiselsberg, Maximilian

facultas, 2024

ISBN 978-3-7089-2453-3 | 2024-02-19 | 08 Recht

Fakultaetsbibliothek SoWi: MCI-I, Universitätsstr. 15, 021-Eise [verfügbar]

Buchcover

FlexKapGG / Flexible Kapitalgesellschafts-Gesetz Kurzkommentar

Linde Verlag GesmbH, 2024

ISBN 978-3-7073-4926-9 | 2024-02-29 | 08 Recht

e-Medien: https://www.lindedigital.at/plink/ko-kkflexkapgg

Buchcover

Flight Levels Organisationen mit Business-Agilität führen

Leopold, Klaus

dpunktverlag, 2023

ISBN 978-3-86490-971-9 | 2024-02-19 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 334-Leop [verfügbar]

Buchcover

Flugzeuge der Traum vom Fliegen

Tessloff, 2014

ISBN 978-3-7886-2057-8 | 2024-02-23 | 37 Technik allgemein

Bibliothekszentrum West: Lesesaal, N30717/10 [verfügbar]

Buchcover

Formeln der Technik Elektrotechnik, Maschinenbautechnik, Chemietechnik, Mathematik/Physik

Bach, Ewald.

Verlag Europa-Lehrmittel, 2023

ISBN 978-3-8085-5324-4 | 2024-02-05 | 41 Bauingenieurwesen

Bibliothekszentrum West: Freihand, 800/ZG 8590 B118(5) [verfügbar]

Buchcover

Forschen in Sammlungen Dynamiken, Transformationen, Perspektiven

"Forschen in Sammlungen. 5 Jahre Forschungsverbund Marbach Weimar Wolfenbüttel. Ergebnisse und Perspektiven“ Hannover 2018 Veranstaltung

Wallstein Verlag, 2024

ISBN 978-3-8353-3573-8 | 2024-02-13 | 03 Information und Dokumentation, Buch- und Bibliothekswesen

Hauptbibliothek: Sondersammlungen Lesesaal, 742775 [verfügbar]

Buchcover

Franz von Defregger - Lebenserinnerungen eines "Malerfürsten"

Defregger, Franz von

Allitera Verlag, November 2021

ISBN 978-3-96233-294-5 | 2024-02-12 | 45 Kunst

Hauptbibliothek: Lesesaal, 653601 [verfügbar]

Buchcover

Frauen machen Mode Coco Chanel, Jil Sander, Vivienne Westwood u.a.m. ; Modeschöpferinnen vom 18. Jahrhundert bis heute

Lehnert, Gertrud

Ed Ebersbach, 1998

ISBN 978-3-931782-24-5 | 2024-02-06 | 45 Kunst

Hauptbibliothek: Magazin HB, 742779 [verfügbar]

Buchcover

Fremde Feldzüge europäische Kriegsbeobachter in den Kriegen Japans, des Osmanischen Reichs und der USA, 1894–1898

Rohé, Niko

Vandenhoeck & Ruprecht; Böhlau Verlag, 2024

ISBN 978-3-412-52853-9 | 2024-02-27 | 54 Geschichte


Beschreibung: Die Kriege Japans gegen China, des Osmanischen Reichs gegen Griechenland und der USA gegen Spanien konfrontierten die Großmächte in den 1890er-Jahren mit sich verändernden imperialen Ordnungen. Als Augenzeugen, Mittler und Experten rückten Kriegsbeobachterinnen und -beobachter in Schlüsselrollen bei der Bewertung und Verortung der Ereignisse und der Verteidigung europäischer Führungsansprüche.Das Werk behandelt die europäische Kriegsbeobachtung, -bewertung und -einordnung von in der Forschung bisher wenig beachteten japanischen, osmanischen und amerikanischen Feldzügen während der 1890er-Jahre. Der chinesisch-japanische Krieg 1894/95, der griechisch-türkische Krieg 1897 und der spanisch-amerikanische Krieg 1898 fielen in eine Zeit des Friedens in Europa und lösten dort reges Interesse aus. Krieg galt als historische Notwendigkeit und ordnungsstiftende Kraft. Für Kriegsbeobachterinnen und Kriegsbeobachter, so die Ausgangshypothese, waren die drei Feldzüge indes Chancen und Herausforderungen zugleich: Einerseits boten sie den meist männlichen Kriegsberichterstattern, Militärs und Diplomaten, aber auch Medizinern und Krankenschwestern, seltene Einblicke in See- und Landschlachten zwischen regulären Streitkräften mit modernen Waffen. Andererseits verlangten sie von ihnen, die ‚fremden‘ Kriegserfolge mit eigenen Weltordnungsvorstellungen in Einklang zu bringen. Die Arbeit zeigt die europäischen Akteure in einer für die Hochzeit der imperialen Expansion ungewohnten, aber geteilten Rolle: als Beobachtende in Kriegen ohne Beteiligung der Großmächte.

e-Medien: https://doi.org/10.7788/9783412528539

Buchcover

Führen in der Arbeitswelt der Zukunft Instrumente, Techniken und Best-Practice-Beispiele

Franken, Swetlana

Springer Gabler, 2022

ISBN 978-3-658-38371-8 | 2024-02-15 | 08 Recht

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Gabriele Saint-Genois a jej výzdoba vily v bratislavskom Horskom parku

Galeria mesta Bratislavy, 2019

ISBN 978-80-89340-96-5 | 2024-02-07 | 45 Kunst

Hauptbibliothek: Magazin HB, 388604 [verfügbar]

Buchcover

Game-based Learning im STEAM-Unterricht Den Strahlensatz mit digitalen Medien begreifen

Huber, Elena

2024

2024-02-29 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Angesichts des anhaltend starken Interesses von Kindern und Jugendlichen an digitalen Spielen sowie ihrer regelmäßigen Nutzung eröffnen sich vielversprechende Möglichkeiten, Bildungsprozesse mithilfe spielbasierter Aufbereitungen attraktiver für Lernende zu gestalten (Bhuiyan & Mahmud, 2015; Feierabend et al., 2022). (Digital) Game-based Learning beschäftigt sich mit dem Prozess und der Praxis des Lernens mittels (digitaler) Spiele. Spielbasiertes Lernen soll es ermöglichen, Schüler*innen nützliches Wissen sowie neue Fähigkeiten, Kompetenzen und Denkweisen näher zu bringen (Becker, 2021; Wechselberger, 2009). Diese Studie hatte zum Ziel, einen digitalen Lernpfad zu entwickeln und zu testen, welcher Schüler*innen dabei unterstützt, mathematische Kompetenzen zum zweiten Strahlensatz zu erlangen. Der Lernpfad wurde auf Grundlage umfangreicher Literaturrecherche konzipiert und enthält nicht nur wesentliche Spielelemente, sondern kann im Sinne der STEAM-Bildung interdisziplinär eingesetzt werden. Die Erprobung des entworfenen Lerndesigns erfolgte in zwei Implementierungsphasen mit 15 Schüler*innen der Sekundarstufe I in Innsbruck. Neben der konkreten Gestaltung des Lernpfads richtet sich der Fokus dieser designbasierten Forschung auf angestrebte Lernziele beziehungsweise Kompetenzen der Teilnehmer*innen. Zu den größten Herausforderungen bei der Erstellung und Implementierung eines Lernpfads zählen das Finden eines relevanten schüler*innenorientierten Themas, das sorgfältige Vorbereiten des Lernmaterials sowie das Motivieren der Kinder. Außerdem ist es wichtig, als Lehrperson zu wissen, wie mit technischen Hürden und Fehlern im Unterricht umgegangen werden soll. Für die Transformation des erstellten digitalen Lernpfads in ein interaktives Lernspiel konnten wesentliche Ideen von Kindern mit Hinweisen aus der Fachliteratur verknüpft und festgehalten werden. Die Ergebnisse dieser Studie haben einerseits gezeigt, dass Kinder mit Hilfe des Lernpfads wesentliche Kompetenzen zum zweiten Strahlensatz erlangen konnten. Andererseits ließen sich aus den Resultaten der Forschung allgemeine Designprinzipien für den Einsatz von Lernspielen im Unterricht ableiten. Diese können als Empfehlungen verstanden werden und sollen Lehrpersonen Orientierung geben: (1) Schaffen Sie Raum und Zeit, damit Schüler*innen ihre Ideen und Ergebnisse reflektieren können. (2) Ermöglichen Sie Interaktion und Diskussion unter Schüler*innen und fördern Sie soziale Aktivitäten. (3) Beziehen Sie sowohl physische als auch virtuelle Lernmaterialien mit ein. (4) Schaffen Sie reichhaltige, realistische Situationen im Unterricht. (5) Arbeiten Sie mit Kindern gemeinsam an der Themenfindung und beziehen Sie deren Interessen mit ein.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-145087

Buchcover

Gameday Experience in Spectator Sport A Case Study on Swarco Raiders Tirol

Hofherr, Franz-Josef

2023

2024-02-22 | 58 Fachlich nicht erfasste Objekte


Beschreibung: eng: Although customer experience, event quality, and spectator-based brand equity have gained enormous attention in the marketing literature, no research has yet combined these three streams. This study combines these three streams and calls it the gameday experience. This paper discusses the topics and definitions regarding customer experience, event quality, and spectator-based brand equity. The purpose of this study is to investigate these three constructs and have a closer look at their influence on customers' loyalty and willingness to pay (WTP). Moreover, this study aims to investigate the moderating effect of product knowledge. A quantitative approach was conducted. The analysis shows that the customer experience and spectator-based brand equity influence the customers' loyalty. Correspondingly, some subdimension of the event quality constructs do also influence loyalty. There was no influence of these constructs on the WTP found. Also, there was no moderating effect of product knowledge between the relationships of the mentioned constructs and WTP. There was a moderating effect of product knowledge between the relationship of the brand equity dimension awareness and loyalty found. This study helps to gain deeper insights into the gameday experience in spectator sports. The theoretical and managerial significance of the findings are discussed, limitations and suggestions for further research are proposed.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-131350

Buchcover

Gebrochen-Weiß Roman

Roemer, Astrid

Residenz Verlag, 2023

ISBN 978-3-7017-1767-5 | 2024-02-26 | 56 Belletristik und Spielfilme

Hauptbibliothek: Freihand, 600/GU 67825 G29.2023 [verfügbar]

Buchcover

Gedankenflügge Aphorismen

Herz-Kestranek, Miguel

Ibera, 2022

ISBN 978-3-85052-411-7 | 2024-02-16 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 355454 [verfügbar]

Buchcover

Gedankenspiele über die Toleranz

Streeruwitz, Marlene

Literaturverlag Droschl, 2023

ISBN 978-3-99059-146-8 | 2024-02-23 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 355470 [verfügbar]

Buchcover

Gefangen in Mauthausen

Vandenhoeck & Ruprecht; Böhlau, 2024

ISBN 978-3-205-21537-0 | 2024-02-27 | 54 Geschichte

e-Medien: https://doi.org/10.7767/9783205215370

Buchcover

Geheimnis Tiefsee Leben in ewiger Finsternis

Tessloff, 2013

ISBN 978-3-7886-2070-7 | 2024-02-26 | 27 Biologie allgemein

Bibliothekszentrum West: Lesesaal, N30717/133 [verfügbar]

Buchcover

Geheimnisvolle Unterwasserwelt von Fischen, Krebsen, Muscheln, Schnecken und mehr

Merkel, Mario

Natur + Text, 2021

ISBN 978-3-942062-52-7 | 2024-02-15 | 29 Zoologie

Bibliothekszentrum West: Freihand, 800/WI 4700 M563 [verfügbar]

Buchcover

Gender-Bericht 2022 Frauen und Männer in Südtirol - Lebenswelten im Vergleich = Rapporto gender 2022 : universo femminile e maschile a confronto in Alto Adige

Auer, Stefanie

Landesinstut für Statistik, 2023

2024-02-13 | 11 Soziologie und Kulturwissenschaften

Hauptbibliothek: Magazin HB, 55387/239 [verfügbar]

Buchcover

Gender-Studien eine Einführung

Metzler, 2006

ISBN 978-3-476-02143-4 | 2024-02-29 | 11 Soziologie und Kulturwissenschaften

Hauptbibliothek: Magazin HB, 742852 [verfügbar]

Buchcover

Genius loci der gebauten Umwelt in Syrien von der Kultur zur Architektur, dargestellt unter besonderer Verarbeitung traditioneller Beispiele aus der Region ??b

Sabour, Bassam

wbg Academic, 2023

ISBN 978-3-534-40802-3 | 2024-02-19 | 42 Architektur

Zentraldepot: Externmagazin I, T236634 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2023

ISBN 978-3-8379-2422-0 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-22,2 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2023

ISBN 978-3-8379-2422-0 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-22,1 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2022

ISBN 978-3-8379-2421-3 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-21 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2021

ISBN 978-3-8379-2420-6 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-20 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2021

ISBN 978-3-8379-2419-0 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-19 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2021

ISBN 978-3-8379-2418-3 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-18 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2020

ISBN 978-3-8379-2417-6 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-17 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2020

ISBN 978-3-8379-2415-2 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-15 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2020

ISBN 978-3-8379-2414-5 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-14 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2018

ISBN 978-3-8379-2413-8 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-13 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2018

ISBN 978-3-8379-2412-1 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-12 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2018

ISBN 978-3-8379-2411-4 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-11 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2018

ISBN 978-3-8379-2410-7 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-10 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2017

ISBN 978-3-8379-2409-1 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-9 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2017

ISBN 978-3-8379-2408-4 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-8 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2017

ISBN 978-3-8379-2407-7 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-7 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2017

ISBN 978-3-8379-2406-0 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-6 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2015

ISBN 978-3-8379-2405-3 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-5 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2015

ISBN 978-3-8379-2505-0 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-4 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2015

ISBN 978-3-8379-2505-0 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-3 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2015

ISBN 978-3-8379-2505-0 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-2 [verfügbar]

Buchcover

Gesamtausgabe

Freud, Sigmund

Psychosozial-Verlag, 2015

ISBN 978-3-8379-2505-0 | 2024-02-27 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 2560.2015-1 [verfügbar]

Buchcover

Geschlechtsunterschiede in der Empfänglichkeit für sexuelle Angebote Der Einfluss intrasexueller Unterschiede im klassischen Feldexperiment von Clark und Hatfield (1989)

Kunz, Sascha

2023

2024-02-29 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Die vorliegende Untersuchung überprüfte und erweiterte das berühmte Feldexperiment Gender Differences in Receptivity to Sexual Offers von Clark und Hatfield aus dem Jahr 1989, wonach Männer und Frauen unterschiedlich empfänglich gegenüber sexuellen Angeboten einer fremden Person sind. Untersucht wurde, ob sich Männer und Frauen in ihrer Empfänglichkeit für sexuelle Angebote generell unterscheiden und ob die Explizitheit des sexuellen Angebots unterschiedliche Auswirkungen auf die Zustimmungsraten von Männern und Frauen hat. Darüber hinaus wurde untersucht, ob sich die unterschiedlichen Zustimmungsraten von Männern und Frauen auf Unterschiede in ihrer Soziosexualität zurückführen lassen. Sechs männliche und sieben weibliche Konföderierte sprachen 72 Männer und 72 Frauen an verschiedenen Universitätsstandorten an und fragten sie nach einem Date, einem Treffen in der eigenen Wohnung oder nach Sex. Die Ergebnisse zeigen, dass mehr Männer als Frauen dem Angebot zustimmten und dass die Explizitheit des sexuellen Angebots keinen Einfluss auf die Zustimmungsraten beider Geschlechter hatte. Die Unterschiede in den Zustimmungsraten von Männern und Frauen lassen sich nicht auf ihre Soziosexualität zurückführen. Die vorliegende Studie stützt damit das Ergebnis der Originalstudie und ihrer Replikationen, wonach sich Männer und Frauen in ihrer Empfänglichkeit für sexuelle Angebote unterscheiden und Geschlecht der beste Prädiktor für diesen Unterschied ist.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-142711

Buchcover

Geschwister in Narrativen : Entwurf eines Geschichtenergänzungsverfahrens zur Untersuchung kindlicher Geschwisterrepräsentanzen

Steiner, Selina Beate

Masterarbeit, Universität Innsbruck, 2022 - Volltext: BibSearch

2024-02-26 | 05 Psychologie

Hauptbibliothek: Magazin HB, DG67796 [verfügbar]

Buchcover

Gespeicherte Gefühle über die Affekte im Archiv

De Gruyter, 2024

ISBN 978-3-11-107782-6 | 2024-02-08 | 03 Information und Dokumentation, Buch- und Bibliothekswesen

Brenner-Archiv: Bibliothek, IV-1135 [verfügbar]

Buchcover

Gesundheit für alle: Reflexionen und Zukunftstrends

Verlag Österreich, 2023

ISBN 978-3-7046-9243-6 | 2024-02-15 | 08 Recht

e-Medien: https://doi.org/10.33196/9783704692436

Buchcover

Gesundheitsökonomie eine Einführung

Beek, Kornelia van der

De Gruyter Oldenbourg, 2024

ISBN 978-3-486-76369-0 | 2024-02-27 | 12 Volkswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 202-Beek|b [verfügbar]

Buchcover

Gewerbeausschlussgründe im GmbH-Recht

Mayr-Stumpf, Lisa

Verlag Österreich, 2023

ISBN 978-3-7046-9338-9 | 2024-02-15 | 08 Recht

e-Medien: https://doi.org/10.33196/9783704693389

Buchcover

Giorgis Rodriguez

Quart, 2023

ISBN 978-3-03761-256-9 | 2024-02-14 | 42 Architektur

Zentraldepot: Externmagazin I, T173383 [verfügbar]

Buchcover

Gläubiger ohne Risiko der Empty Creditor im deutschen Insolvenzrecht

Koa, Kenny

Nomos, 2020

ISBN 978-3-8487-6427-3 | 2024-02-12 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilgerichtliches Verfahren, [verfügbar]

Buchcover

Glass houses

Phaidon, 2023

ISBN 978-1-83866-750-4 | 2024-02-12 | 42 Architektur


Beschreibung: Eine inspirierende Sammlung von 50 spektakulären Häusern, die fast vollständig aus Glas gebaut wurden Glass Houses präsentiert 50 atemberaubende, von Architekten entworfene Häuser, die Glas optimal nutzen. Die internationale Auswahl umfasst Häuser der frühen Moderne aus den 1930er Jahren, wie Philip Johnsons Glass House und Mies van der Rohes Farnsworth House, und glamouröse Villen aus der Mitte des Jahrhunderts in Los Angeles, wie Pierre Koenigs Case Study #22, sowie herausragende zeitgenössische Beispiele, bei denen neue Innovationen noch gewagtere Glaskonstruktionen möglich gemacht haben. Jedes Haus wird mit beeindruckenden Fotos vorgestellt, die die dynamischen, lichtdurchfluteten Lebensräume zeigen, die nur Glas bieten kann. Enthält Häuser in: Australien, Brasilien, Chile, Tschechische Republik, Ecuador, Finnland, Frankreich, Deutschland, Italien, Japan, Mexiko, Spanien, Südafrika, Schweden, Schweiz, Niederlande, Vereinigtes Königreich, USA und Vietnam Mit Architekten wie: Tatiana Bilbao, Lina Bo Bardi, Ofis Arhitekti, Herzog & de Meuron, Hiroshi Nakamura, Kazuyo Sejima, Philip Johnson, Mecanoo, John Lautner, Richard Rogers, und Ludwig Mies van der Rohe

Bibliothekszentrum West: Freihand, 800/ZH 5100 T323 [verfügbar]

Buchcover

Glauben korrelativ kommunizieren Annäherungen an das religionspädagogische Korrelationsprinzip

Porzelt, Burkard

Verlag Julius Klinkhardt GmbH & Co KG, 2023

ISBN 978-3-8252-6128-3 | 2024-02-12 | 06 Religion, Theologie

Fachbibliothek Theologie: Freihand, RP 10-052 PORZ [verfügbar]

Buchcover

Globale Krisen in der Psychotherapie : therapeutisch konstruktiv in schwierigen Zeiten arbeiten : mit E-Book inside und Arbeitsmaterial

Chmielewski, Fabian,,

Beltz, 2023

ISBN 978-3-621-29022-7 | 2024-02-26 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 8000 C544 [verfügbar]

Buchcover

Grave stelae from Thessaly Larissa, the Diachronic Museum and the other archaeological collections of the Larissa Ephorate of Antiquities

Lebent?, Iphigeneia 20./21. Jh.

Academy of Athens, 2023

ISBN 978-960-404-409-2 | 2024-02-14 | 58 Fachlich nicht erfasste Objekte

Fachbibliothek Altertumswissenschaften: Freihand, 650/LG 2500 C822 G84-3,3 [verfügbar]

Buchcover

Grenze/Granica : art on the German-Polish border after 1990

Dogramaci, Burcu

Vandenhoeck & Ruprecht; Böhlau, 2024

ISBN 978-3-412-52883-6 | 2024-03-01 | 45 Kunst


Beschreibung: Abstract This book sets out to analyse for the very first time a selection of works by international contemporary artists that reference the German-Polish border, and to draw attention to artworks created between 1990 and the early 2020s. The projects explored reference narratives of expulsion and the fluid, spectral and aesthetic nature of borders through sensory and somaesthetic perception. They examine the historical shifts of that border from the angle of changing political and societal contexts, lost homelands, expulsion of people and new political orders.The book is the product of research in the field at the German-Polish border, interviews with artists, visits to their studios, and archival work. It employs a transdisciplinary toolbox, combining methods from art history, border (art) studies, migration studies, memory studies, geopoetics, limotrophy and more. The volume questions the double figure of dividing and sharing that finds expression in the German word eine (Grenze) teilen, which means either to divide or to share a border: separation by a shared border and shared historical experience, regarded from two, often dissimilar perspectives. The study focuses on artistic projects ranging from photography to installation art and artistic methods from mapping to re-enacting, which address the issue of the borderland as a dynamic transition space.

e-Medien: https://doi.org/10.7788/9783412528836

Buchcover

Grenzenlose Verwandlung Hugo von Hofmannsthal : Biographie

Dangel-Pelloquin, Elsbeth

S FISCHER, 2024

ISBN 978-3-10-397553-6 | 2024-01-30 | 17 Germanistik, Skandinavistik, Niederlandistik

Brenner-Archiv: Bibliothek, III-4315 [verfügbar]

Buchcover

Grenzfall : in den Tiefen der Schuld : Kriminalroman

Schneider, Anna

FISCHER Taschenbuch, 2024

ISBN 978-3-596-70819-2 | 2024-02-06 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 653603 [verfügbar]

Buchcover

Griechen im Heiligen Römischen Reich Migration und ihre wissensgeschichtliche Bedeutung

Saracino, Stefano

De Gruyter Oldenbourg, 2024

ISBN 978-3-11-119438-7 | 2024-02-13 | 54 Geschichte

e-Medien: https://www.degruyter.com/isbn/9783111194257

Buchcover

Grundzüge des Internationalen Wirtschaftsrechts Internationales Privatrecht, Europäisches Wirtschaftsrecht, Welthandelsrecht

Enders, Theodor

Verlag Franz Vahlen, 2021

ISBN 978-3-8006-6686-7 | 2024-02-19 | 08 Recht

Fachbibliothek Recht: Bibliothek für Völkerrecht, [verfügbar]

Buchcover

Gruppenvergleiche im Kontext von Bildung für nachhaltige Entwicklung

Boch, Anna-Lena

2024

2024-02-29 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Gegenwärtig sind gigantische Datenmengen zu relevanten gesellschaftlichen Themen verfügbar, die es gilt, mit Hilfe von Statistiken zu verstehen, um als mündige*r Bürger*in an der Gesellschaft teilhaben zu können. Um den Aufbau der dafür notwendigen Kompetenzen auf eine realistische Art und Weise zu fördern, wird der Vergleich von realen Daten mittels Boxplots als angemessener Lernanlass angesehen. Diese designbasierte Masterarbeit analysiert daher, wie eine Lehr-Lern-Strategie, welche in eine statistische Lernumgebung nach Ben-Zvi et al. (2018) eingebettet ist, Schüler*innen der Sekundarstufe II beim Erwerb von statistischen Kompetenzen zu Gruppenvergleichen im Kontext für Bildung für nachhaltige Entwicklung unterstützen kann. Der Fokus der Studie richtet sich auf reale Daten zu den Zielen nachhaltiger Entwicklung betreffend Hunger sowie Gesundheit und Wohlergehen. Eine Haupterkenntnis der empirischen Untersuchung ist, dass insbesondere die Vertrautheit der Lernenden mit dem Problemkontext die Qualität der statistischen Schlussfolgerungen und das Ausmaß der Verbindung zwischen Daten und Kontext erheblich beeinflussen können. Die Ergebnisse deuten darauf hin, dass wenn Lernende mit dem Kontext vertraut sind, sie dazu tendieren, Kennzahlen von Gruppen eher miteinander zu vergleichen, mehr Informationen aus den Boxplots herauslesen und eher dazu bereit sind, weitere Informationen über ein Thema im Internet zu recherchieren. Neben der Vertrautheit mit dem Problemkontext könnte auch das Wiederholen der gleichen Aufgabenstellungen als Auslöser angesehen werden, der es Lernenden ermöglicht, in eine für sie neue Disziplin einzutauchen und spezifische Denkwerkzeuge zu entwickeln. Der designbasierten Forschung folgend wurden in der Masterarbeit folgende Unterrichtsprinzipien ausgearbeitet: (1) Verwendung von angemessene Hilfestellungen beim Einsatz von technologischen Tools (2) Aufbau eines fundierten Grundverständnisses über die benötigten statistischen Konzepte (3) Verwendung von inhaltlich und methodisch ab-wechslungsreichen Aufgaben, die ein gewisses Maß an Struktur bieten (4) Gezieltes ein- und ausblenden eines Kontextes, der den Lernenden vertraut ist (5 & 6) Reflexionsmöglichkeiten über die gezogenen Schlussfolgerungen und erstellten Kurzvideos und (7) Möglichkeiten der Diskussion und Kommunikation der Ergebnisse.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-145074

Buchcover

Hakomi - Achtsamkeitszentrierte Körperpsychotherapie Theorie und Praxis

Klett-Cotta, 2021

ISBN 978-3-608-96324-3 | 2024-02-12 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 8520 W429(2) [verfügbar]

Buchcover

Hals über Kopf Roman

Reichs, Kathy,,

Blanvalet, 2008

ISBN 978-3-442-36976-8 | 2024-02-12 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742769 [verfügbar]

Buchcover

Handbuch Bauwerksprüfung Zustandsprüfung im Bestand: Standsicherheit, Verkehrssicherheit, Dauerhaftigkeit

RM Rudolf Müller, 2023

ISBN 978-3-481-04071-0 | 2024-02-12 | 41 Bauingenieurwesen

Bibliothekszentrum West: Freihand, 800/ZI 4930 M575(2) [verfügbar]

Buchcover

Handbuch der Aufnahmetechnik für röntgendiagnostische Berufe : aus der Praxis für die Praxis

Strickner, Elisabeth

Studia Verlag, 2024

ISBN 978-3-99105-036-0 | 2024-02-08 | 34 Medizin und Pflege

Hauptbibliothek: Magazin HB, 653600 [verfügbar]

Buchcover

Handbuch der Beweislast

Baumgärtel, Gottfried

Carl Heymanns Verlag, 2023

ISBN 978-3-452-29835-5 | 2024-02-22 | 08 Recht

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Handbuch Kurzzeitvermietung am Beispiel von Airbnb mit besonderem Fokus auf Wien

Seidl, Leo Matthias

Jan Sramek Verlag, 2023

ISBN 978-3-7097-0347-2 | 2024-02-13 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Handbuch Medien im Geschichtsunterricht

Wochenschau Verlag, 2017

ISBN 978-3-89974-665-5 | 2024-02-05 | 54 Geschichte

Hauptbibliothek: Freihand, 600/NB 8500 P189(7) [verfügbar]

Buchcover

Handbuch Sportklettern

Gauster, Herta

Alpenverein Österreich, 2022

ISBN 978-3-7022-4006-6 | 2024-02-14 | 49 Sport und Spiele

Hauptbibliothek: Magazin HB, 672652 [verfügbar]

Buchcover

Hans Pontiller 1887-1970

Athesia-Tyrolia Druck GmbH; Dr Traute Pontiller, 2023

ISBN 978-3-200-09455-0 | 2024-02-08 | 45 Kunst

Brenner-Archiv: Bibliothek, V-548 [verfügbar]

Buchcover

Haustiere - unsere liebsten Freunde

Hackbarth, Annette

Tessloff, 2015

ISBN 978-3-7886-2093-6 | 2024-02-23 | 43 Land-, Forst- und Hauswirtschaft

Bibliothekszentrum West: Lesesaal, N30717/72 [verfügbar]

Buchcover

Heilkunst : zur Geschichte der Medizin : 09. April bis 31. Oktober 2022, 01. April bis 31. Oktober 2023

Schloss Trautenfels Universalmuseum Joanneum, 2023

ISBN 978-3-903179-64-6 | 2024-02-15 | 34 Medizin und Pflege

Hauptbibliothek: Sondersammlungen Lesesaal, 388616 [verfügbar]

Buchcover

Hey, dein Körper spricht! worum es bei Körpersprache wirklich geht

Verra, Stefan

Edel Books, 2015

ISBN 978-3-8419-0325-9 | 2024-02-23 | 05 Psychologie

Hauptbibliothek: Magazin HB, 742843 [verfügbar]

Buchcover

High energy astrophysics ; 2 Stars, the galaxy and the interstellar medium

Cambridge Univ Press, 1994

ISBN 978-1-139-17050-5 | 2024-02-22 | 33 Physik

e-Medien: https://doi.org/10.1017/CBO9781139170505

Buchcover

High Energy die Achtziger - das pulsierende Jahrzehnt

Balzer, Jens

Rowohlt Berlin, Juli 2021

ISBN 978-3-7371-0114-1 | 2024-02-26 | 11 Soziologie und Kulturwissenschaften

Bibliothek Haus der Musik: Freihand, O.22-38 [reserviert]

Buchcover

Historisch-kritisches Wörterbuch des Marxismus

Argument, 2023

ISBN 978-3-88619-443-8 | 2024-02-20 | 04 Philosophie


Beschreibung: Am »Historisch-kritischen Wörterbuch des Marxismus« (HKWM) arbeiten mehr als tausend Forschende aus aller Welt. Viele der Stichwörter entstammen der politisch-theoretischen Lexik der Gegenwart wie ›Klimapolitik‹, ›Klonen‹ und ›Kopftuchstreit‹, greifen Entwicklungen der wissenschaftlich-technischen Revolution auf wie ›Hightech-Industrie‹, ›Künstliche Intelligenz‹ und ›Informationsrente‹; sie betreten lexikalisches Neuland mit historischen Individualitätsformen wie ›Hausfrau‹ oder ›Marxistsein/Marxistinsein‹ und zeigen das Wörterbuch insgesamt als Arche Noah von Stichwörtern, in denen sich jahrhundertealtes Befreiungswissen mit Herrschaftskritik verdichtet, all dies im steten Ringen um Erkenntnis für politische Handlungsfähigkeit auf der Höhe der Zeit. Das HKWM ist auf 15 Bände mit insgesamt über 1500 Stichwortartikeln angelegt. (https://www.buchhandel.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 006-His9,2 [verfügbar]

Buchcover

Historisch-politische Mitteilungen Archiv für christlich-demokratische Politik

Vandenhoeck & Ruprecht; Böhlau Verlag, 2023

ISBN 978-3-412-52930-7 | 2024-02-26 | 54 Geschichte


Beschreibung: Zusammenfassung Die „Historisch-Politischen Mitteilungen“ der Konrad-Adenauer-Stiftung sind ein Forum für Forschungen und Darstellungen zur Geschichte christlich-demokratischer Bewegungen und Parteien in Deutschland und Europa. In Band 30 befassen sich Agilolf Kesselring und Thorsten Loch mit der „Ehrenerklärung“ Konrad Adenauers für die Angehörigen der Wehrmacht vom 3.12.1952. Rudolf Uertz behandelt die frühe Wirtschafts- und Sozialprogrammatik der CDU, Benedikt Brunner die geistige Entwicklung des früheren Bundestagspräsidenten Hermann Ehlers und seine Rolle bei der Gründung des Evangelischen Arbeitskreises der CDU/CSU. Hanns Jürgen Küsters schildert, welche Lehren der CDU-Politiker Kai-Uwe von Hassel aus seinen langjährigen Erfahrungen zog. Josefine Preißler untersucht die Frühgeschichte des Studienzentrums Schloss Weikersheim als Versuch eines konservativen „Thinktanks“, Rebecca Schröder die Rolle des Archivs für Christlich-Demokratische Politik als europapolitisches Gedächtnis der Christlichen Demokratie. Außerdem enthalten sind Beiträge der Tagung „Helmut Kohl und die Kirchen“ von Markus Raasch, Jürgen Plöhn, Michael Borchard und Antonius Liedhegener sowie eine Darstellung zur Finanzierung der deutschen Einheit des hierfür maßgeblich verantwortlichen Bundesministers a. D. Theo Waigel und seines damaligen Staatssekretärs Walther Otremba.

e-Medien: https://doi.org/10.7788/9783412529307

Buchcover

"Hören Sie einmal wieder ein Wort aus unserem Thale" Ötztal und Schnals in Zeitungsberichten und Bildern 1848-1918

Schwarz, Manfred

Pro Vita Alpina, März 2023

2024-02-19 | 53 Volkskunde

Hauptbibliothek: Magazin HB, 653593 [verfügbar]

Buchcover

Holz_Haus_Tage 2023 19.-20. Oktober 2023, Bad Ischl : Tagungsband

Holz_Haus_Tage Bad Ischl 2023

Holzforschung Austria, Oktober 2023

ISBN 978-3-9519933-9-3 | 2024-02-12 | 41 Bauingenieurwesen

Zentraldepot: Externmagazin I, T173381 [verfügbar]

Buchcover

Homiletische Transkreation Wechselwirkungen zwischen Bibeltext- und Predigtgattungen

Gräßlin, Manuel

Echter Verlag; Vandenhoeck & Ruprecht, 2024

ISBN 978-3-666-50048-0 | 2024-02-29 | 06 Religion, Theologie

e-Medien: https://doi.org/10.13109/9783666500480

Buchcover

Homo cyber : ein Bericht aus Digitalien

Reichl, Peter

müry salzmann, 2023

ISBN 978-3-99014-247-9 | 2024-02-16 | 24 Informatik

Hauptbibliothek: Magazin HB, 742816 [verfügbar]

Buchcover

Houses II

Schütte, Thomas

Jovis, 2023

ISBN 978-3-98612-060-3 | 2024-02-12 | 42 Architektur

Bibliothekszentrum West: Freihand, 800/ZH 4800 S385 H8 [verfügbar]

Buchcover

Humoristischer Widerstand Eine diskursanalytische Perspektive auf feministische Elemente in der deutschsprachigen Stand-Up Comedy

Schwarz, Miriam

2024

2024-02-22 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Comedy in ihren verschiedenen Darstellungsformen ist zu einem wichtigen Bestandteil der Populärkultur geworden und hat auch die Aufmerksamkeit verschiedener Forschungsgebiete auf sich gezogen, welche anerkennen, dass Comedy in der heutigen Zeit eine zentrale Rolle in der öffentlichen Debatte und Kultur einnimmt und dabei als Spiegel und Kritiker gesellschaftlicher Normen und Praktiken dienen kann. br /Die vorliegende Arbeit positioniert sich an der Schnittstelle von Humorforschung und Gender Studies und untersucht dabei, wie Stand-Up Comedy von Comediennes genutzt wird, um gesellschaftliche Praktiken und Normen nicht nur zu reflektieren, sondern auch um Alternativen aufzuzeigen. Es wird der Frage nachgegangen, wie Comediennes im deutschsprachigen Raum in ihren Stand-Up Comedy-Performances Geschlecht und Geschlechterungleichheit thematisieren und problematisieren und welche Aspekte der Geschlechterungleichheit in den Vordergrund gerückt werden. br /Die theoretische Untermauerung dieses Vorhabens basiert auf der Hegemonietheorie, die zusammen mit anderen Theorien des Humors und insbesondere des feministischen Humors genutzt wird, um ein Schema des feministisch-widerständigen Humors zu erstellen. Dieser stark literaturbasierte Schritt wird dann mit einer empirischen Analyse von 20 aktuellen Stand-Up Comedy-Performances im deutschsprachigen Raum kombiniert. Mithilfe der Critical Discourse Analysis nach Fairclough werden die Transkripte dieser Auftritte analysiert, um sowohl die Themen als auch die angewandten rhetorischen und performativen Strategien herauszuarbeiten, welche die Comediennes in ihren Performances verwenden.br /Im Kontext der wachsenden deutschsprachigen Comedy-Szene zielt diese Forschung darauf ab, bisherige Lücken der Geschlechterforschung im Bereich der Stand-Up Comedy zu schließen. Die Ergebnisse dieser Studie bieten nicht nur Einblicke in die vielfältigen Strategien der Comediennes im Umgang mit Geschlechterungleichheit, sondern tragen auch zur Erweiterung des wissenschaftlichen Verständnisses von Geschlechterungleichheit und alternativen Formen des Widerstands im öffentlichen Raum bei. Darüber hinaus hebt die Arbeit die Bedeutung von Comediennes als wichtige Akteurinnen hervor, die durch ihre Performances marginalisierte Stimmen repräsentieren.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-145976

Buchcover

Hunde Helden auf vier Pfoten

Paxmann, Christine

Tessloff, 2013

ISBN 978-3-7886-2041-7 | 2024-02-26 | 29 Zoologie

Bibliothekszentrum West: Lesesaal, N30717/11 [verfügbar]

Buchcover

Hundertwasser architecture & philosophy = Hundertwasser Architektur & Philosophie

Hundertwasser, Friedensreich

Wörner Verlag, 2023

ISBN 978-3-946177-26-5 | 2024-02-21 | 42 Architektur

Zentraldepot: Externmagazin I, T26030 [verfügbar]

Buchcover

Ich bin … da Gedanken & Erzählungen statt Gedichten

Johannes Christoph

Edition Musica Poetica, 2023

ISBN 978-3-932713-11-8 | 2024-01-26 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742732 [verfügbar]

Buchcover

Ich bin Ornithologe - wer ist mehr? Heiteres und Ernstes über das Leben als Ornithologe

Kalbe, Lothar

Natur + Text, 2019

ISBN 978-3-942062-42-8 | 2024-02-15 | 29 Zoologie

Bibliothekszentrum West: Freihand, 800/WS 1070 K14 [verfügbar]

Buchcover

"Ich will fortleben, auch nach meinem Tod" die Biographie des Tagebuchs der Anne Frank

Sparr, Thomas

S FISCHER, 2023

ISBN 978-3-10-397545-1 | 2024-02-08 | 15 Allgemeine Sprach- und Literaturwissenschaft

Hauptbibliothek: Freihand, 600/GU 64885 S737 [verfügbar]

Buchcover

Il codice della crisi e dell'insolvenza dopo il secondo correttivo commento integrato e aggiornato al d.lgs. 17 giugno 2022, n. 83

Lamanna, Filippo

Giuffrè Francis Lefebvre, 2022

ISBN 978-88-288-4554-6 | 2024-02-16 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Il credito al consumo

Liace, Gianfranco

Giuffrè Francis Lefebvre, 2022

ISBN 978-88-288-4456-3 | 2024-02-22 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Il diritto della crisi e dell'insolvenza

Jorio, Alberto

G Giappichelli, 2023

2024-02-23 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Il nuovo diritto della crisi un'analisi ragionata delle soluzioni volontarie delle crisi

Giappichelli, 2023

2024-02-16 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Il ricorso straordinario al Presidente della Repubblica uno strumento di tutela tra passato e futuro

Urbano, Graziana

Edizioni Scientifiche Italiane, 2023

ISBN 978-88-495-5156-3 | 2024-02-13 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Öffentliches Recht, [verfügbar]

Buchcover

Il trust e gli istituti affini in Italia pianificazione patrimoniale e passaggio generazionale

Rota, Flavio

Giuffrè Francis Lefebvre, 2023

ISBN 978-88-288-5043-4 | 2024-02-22 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Im Hirnsaal Norm und Abweichung

Franzobel

Literaturverlag Droschl, 2023

ISBN 978-3-99059-143-7 | 2024-02-16 | 17 Germanistik, Skandinavistik, Niederlandistik

Hauptbibliothek: Magazin HB, 355453 [verfügbar]

Buchcover

Im Saal der Mörder Roman

James, P. D.

Knaur-Taschenbuch-Verl, 2005

ISBN 978-3-426-62933-8 | 2024-02-20 | 56 Belletristik und Spielfilme


Beschreibung: Von Britanniens regierender Queen of Crime: ein Krimi der alten Schule, so schaurig wie schön. Der Spiegel Ein kleines Privatmuseum im vornehmen Londoner Stadtteil Hampstead wird Schauplatz grausamer Verbrechen. Sie scheinen im Zusammenhang mit Bluttaten aus der Vergangenheit zu stehen, die im berühmten Saal der Mörder des Museums dokumentiert werden: Einer der uneinigen Erben des Museumsgründers wird verbrannt aus seinem Jaguar geborgen, die Leiche einer Frau in einem Koffer entdeckt, nachdem ihr Handy klingelte, und schließlich streckt der unbekannte Täter seine Hand auch nach Tally Clutton aus, der liebenswerten, resoluten alten Dame, die als guter Geist des Hauses in einem Cottage hinter dem Museum wohnt. Die Grand Old Lady des Kriminalromans brilliert einmal mehr mit der Darstellung der verschiedensten Charaktere und Milieus, wenn sie Commander Dalgliesh von Scotland Yard und sein Team den Kreis der Verdächtigen durchforschen lässt.

Hauptbibliothek: Magazin HB, 742805 [verfügbar]

Buchcover

Im Schatten meines Großvaters von Krieg, Trauma und dem Vermächtnis des Schweigens

Findlay, Angela

Europa Verlag, 2023

ISBN 978-3-95890-559-7 | 2024-01-29 | 54 Geschichte

Hauptbibliothek: Magazin HB, 742772 [verfügbar]

Buchcover

Impending crises contemporary fantastic narratives between language, image, and sound

Nomos; Rombach Wissenschaft, 2024

ISBN 978-3-98858-012-2 | 2024-02-14 | 15 Allgemeine Sprach- und Literaturwissenschaft

e-Medien: https://doi.org/10.5771/9783988580122

Buchcover

"In allen guten Buchhandlungen ist zu haben ..." Buchwerbung in Deutschland in der Frühen Neuzeit : mit einer Bibliografie buchhändlerischer Kataloge des 17. und 18. Jahrhunderts

Hauke, Marie-Kristin

Lehmstedt, 2023

ISBN 978-3-95797-148-7 | 2024-02-16 | 03 Information und Dokumentation, Buch- und Bibliothekswesen

Hauptbibliothek: Freihand, 600/AN 44910 H371 [verfügbar]

Buchcover

In Vitro evaluation of a trabecular bony allograft for unstable proximal humerus fractures

Dankl, Lukas.

01/2023

2024-02-29 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Einleitung: Proximale Humerusfrakturen sind eine häufige Verletzung älterer Patienten und betreffen überwiegend Frauen, Patienten mit niedriger Knochendichte sowie Patienten mit schlechter Knochenqualität. Verschieden Behandlungsmethoden, reichend von konservativer Therapie bis hin zur Implantation einer Schulter-Endoprothese, werden in der Literatur beschrieben. Die Invasivität ist hier abhängig von verschiedenen Patienten- und Frakturtyp-spezifischen Faktoren. Besonders bei Frakturen mit Varus-Deformität oder fehlender Abstützung am medialen Kalkar können Komplikationen wie Varus-Kollaps oder Verlust der Reposition auftreten, wenn eine operative Versorgung durchgeführt wird. Strukturelle Allografts finden in der Verstärkung von operativer Versorgung mittels winkelstabiler Implantate besonders bei instabilen Frakturen Anwendung. Daher war es Ziel unserer Stude, die biomechanischen Eigenschaften eines einzigartigen, Pilz-förmigen Allografts als Unterstützung zur winkelstabilen Versorgung von instabilen drei-Teile Frakturen des proximalen Humerus zu untersuchen.br /br /Material und Methoden: Es wurde 24 tiefgekühlte Humeri von Körperspendern aus der hiesigen Abteilung für Anatomie bezogen. Eine instabile drei-Teile Fraktur wurde simuliert und die Humeri in zwei Gruppen zugeteilt. In der Kontroll-Gruppe wurde die Versorgung der Fraktur mit einer winkelstabilen Platte durchgeführt. In der Test-Gruppe wurde ein Pilz-förmiger Allograft individuell aus einem Femur-Kopf geformt, um die Höhle im Inneren des Humerus-Kopfes auszufüllen, und mitsamt der winkelstabilen Platte implantiert. Die Präparate wurden zyklisch mit stufenwiese ansteigender oberer Lastgrenze belastet, die Aufzeichnung von Varus-Verkippung erfolgte mittels einer 3D-Bewegungsanalyse-Software.br /br /Ergebnisse: In der Test-Gruppe zeigte sich eine signifikant erhöhte Anzahl an Belastungszyklen bis zum Versagen (8.342 Belastungszyklen; SD 1.902,4 gegen. 3.475 Belastungszyklen; SD 1,488) sowie eine signifikant erhöhte Last zum Zeitpunkt des Versagens (467,1 N, SD 95,1 N vs. 223,8 N, SD 74,4 N). Zudem wurde zu jedem Beobachtungszeitpunkt in der Test-Gruppe eine signifikant höhere Steifigkeit gemessen.br /br /Diskussion: In dieser Studie konnten wir zeigen, dass ein individuell geformter, Pilz-förmiger Allograft in Kombination mit einer winkelstabilen Platte bei der Versorgung von instabilen drei-Teile Frakturen des proximalen Humerus in der Lage ist, die Last zum Zeitpunkt des Versagens signifikant zur erhöhen. Daher könnte dieser Allograft helfen, Varus Kollaps und den damit verbundenen Verlust der Reposition zu verhindern. Weitere Studien sollten durchgeführt werden, um die Langzeit-Ergebnisse der Frakturversorgung und das Einheilen des Allograftes genauer zu untersuchen.

e-Medien: https://ulb-dok.uibk.ac.at/8312204

Buchcover

In welchem Sinn sind religiöse beliefs rational? Richard Swinburnes Epistemologie religiöser beliefs in „Glaube und Vernunft“

Kerle, Celina

2023

2024-02-29 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Diese Arbeit beschäftigt sich mit der Frage „In welchem Sinn sind religiöse beliefs rational?“ – zu der vermutlich unlösbaren Übersetzungsproblematik (vgl. Kapitel 1.2) – und greift dabei vorwiegend auf Überlegungen aus Swinburnes Buch „Glaube und Vernunft“ zurück. In den Kapiteln der Arbeit gehe ich jeweils zuerst auf die Überlegungen Swinburnes ein, bevor ich Einwände nenne, die gegen seine Position vorgebracht werden können. Das erste Kapitel geht dabei auf Swinburnes Definition des Begriffs belief ein. Außerdem wird auf die Problematik von deutschen Übersetzungen des Ausdrucks „belief“ hingewiesen. Im zweiten Kapitel wird gezeigt, dass diese Definition auch auf religiöse beliefs angewendet wird und deshalb die Grundlage für diese Arbeit bilden kann. Das dritte Kapitel ist den sechs Arten der Rationalität von beliefs nach Swinburne gewidmet, die es ermöglichen, die Rationalität von beliefs zu beurteilen. Das vierte Kapitel beschreibt, wie Swinburne diese sechs Arten von Rationalität auf religiöse beliefs anwendet. Dabei wird ersichtlich, dass die Rationalität von religiösen beliefs von zentraler Bedeutung ist, um eine intersubjektive Nachvollziehbarkeit von Religion zu ermöglichen. Die Frage „Wie rational können religiöse beliefs sein?“ kann abschließend folgendermaßen beantwortet werden: Religiöse beliefs können laut Swinburne ebenso rational sein, wie andere alltägliche und wissenschaftliche beliefs auch. Dabei muss berücksichtigt werden, dass wir nach Swinburne die externalistische Rationalität unserer beliefs nicht beeinflussen können. Somit ist die höchste Stufe von Rationalität, die (religiöse) beliefs erreichen können, diachrone internalistische objektive Rationalität.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-142479

Buchcover

Indexing in Practice

Obermayr, Simon

2024

2024-02-22 | 58 Fachlich nicht erfasste Objekte


Beschreibung: eng: Indexing is a key feature of Relational Database Management Systems (RDBMS) to increase query performance. Diverse query scenarios require different indexing approaches. In combination with the range of different popular RDBMS this results in differing practical implementations of similar concepts. In order to give an overview of these concepts and their performance implication, the different indexing techniques and the respective theoretical backings are illuminated in this thesis. The selected RDBMS namely MariaDB, PostgreSQL, SQL Server and Oracle (XE), are briefly introduced and the available indexing techniques identified. By employing a Python Script and testing databases for each of the selected RDBMS, predefined example queries covering key indexing scenarios are tested to evaluate the practical performance implications of these indexing approaches. Distinct index types within each RDBMS are analyzed, followed by a comprehensive cross-comparison among the selected RDBMS. The query types include point queries, range queries, text-searching queries and spatial queries. Exanimations identify performance differences between the tested RDBMS.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-144815

Buchcover

Indians of the High Plains : from the prehistoric of period to the coming of Europeans

Hyde, George E.

Univ of Oklahama Press, 1970

ISBN 978-0-8061-0438-6 | 2024-02-20 | 53 Volkskunde

Hauptbibliothek: Magazin HB, 742851 [verfügbar]

Buchcover

Influence of macro-nutritional composition on the remission of obesity induced harmful effects on adipose tissue and metabolic fatty liver disease in C57BL/6 mice

Folie, Sabrina

2022

2024-02-28 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Die immer noch steigende Prävalenz der Fettleibigkeit geht mit gefährlichen gesundheitlichen Risiken und Problem einher. Klinische Studien haben gezeigt, dass eine starke Gewichtsabnahme, häufig nur durch bariatrische Operationen und drastische Kalorienreduktion erreichbar, die metabolisch bedingte Fettlebererkrankung (MAFLD), Dysfunktion der Adipozyten und Insulinsensitivität verbessern kann. Bariatrische Operationen gehen aber mit unerwünschten Nebenwirkungen einher und auf die Gewichtsabnahme durch Kalorienrestriktion folgt häufig eine erneute Gewichtszunahme. Ziel hier war es, zu untersuchen, in wie fern eine reine Umstellung der Ernährung, von einer metabolisch schädlichen westlichen Diät, auf eine ausgewogene Standarddiät, MAFLD und Adipozyten-Dysfunktion bei fettleibigen Mäusen reduzieren kann. Dafür wurden männliche C57BL/6-Mäuse 10 Wochen lang mit einer westlichen Diät gefüttert und anschließend für weitere acht Wochen auf eine Standarddiät umgestellt (WD/SD-Mäuse) oder erhielten weiterhin eine westliche Diät (WD/WD-Mäuse) ad libitum. Mäuse, die 18 Wochen lang SD erhielten, dienten als Kontrollgruppe (SD/SD). Die Insulinsensitivität war bei WD/SD- und SD/SD-Mäusen ähnlich, obwohl die WD/SD-Mäuse ein höheres Körpergewicht aufwiesen. Die Beiging-Marker Ucp-1, Cidea und Cox8b waren im subkutanen Fettgewebe von WD/SD-Mäusen im Vergleich zu SD/SD-Mäusen drastisch reduziert. Auch im braunen Fettgewebe waren die morphologischen Merkmale und Marker der Thermogenese sowohl bei WD/SD- als auch bei WD/WD-Mäusen verändert. Die Größe der Fettzellen, Hif1? und die Makrophageninfiltration waren jedoch sowohl im braunen als auch im weißen Fettgewebe von WD/SD-Mäusen im Vergleich zu WD/WD-Mäusen, signifikant geringer. Zusätzlich wurde bei WD/SD-Mäusen eine Verschiebung hin zu dem entzündungshemmenden M2-Phänotyp festgestellt. Obwohl die Lebersteatose durch die Umstellung der Futterzusammensetzung reduziert werden konnte, wiesen 70 % der histologischen Schnitte von WD/SD-Mäusen immer noch eine leichte Steatose auf. Die Verringerung der Steatose lässt sich durch die Wiederherstellung der b-Oxidation und der Mitochondrienfunktion bei WD/SD-Mäusen erklären. Die Fettsäureaufnahme und die De-novo-Lipogenese konnten dagegen durch die Änderung der Nahrungszusammensetzung nicht vollständig normalisiert werden. In den Lebern von WD/SD-Mäusen wurde keine Entzündung festgestellt, was darauf hindeutet, dass ein weiteres Fortschreiten der Lebersteatose in eine nichtalkoholische Steatohepatitis durch eine Änderung der Makronährstoffzusammensetzung verhindert werden kann. Zusammenfassend deuten unsere Daten darauf hin, dass eine Umstellung der Ernährung ausreicht, um die Entzündung des Fettgewebes zu verbessern, während die westliche Ernährung die thermogene Kapazität des braunen und beigen Fettgewebes negativ beeinflusst. Die hepatische Steatose wird durch die Wiederherstellung der b-Oxidation und der mitochondrialen Funktion reduziert, und, wie sich durch die verringerte Entzündung zeigt, wird durch die Ernährungsumstellung ein weiteres Fortschreiten der MAFLD verhindert.

e-Medien: https://ulb-dok.uibk.ac.at/8229965

Buchcover

Ingenuity in the making matter and technique in early modern Europe

University of Pittsburgh Press, 2021

ISBN 978-0-8229-4688-5 | 2024-02-21 | 37 Technik allgemein

Hauptbibliothek: Freihand, 600/ZG 8770 O59 [verfügbar]

Buchcover

Ingroup Bias and Conditional Cooperation in an Online Public Good Game Experiment

Becker, Lara Christiane Rolande

2024

2024-02-29 | 58 Fachlich nicht erfasste Objekte

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-146255

Buchcover

Innere Bilder - äußere Schau Studien zum Mediendispositiv des frühneuzeitlichen Jesuitenordens

Körber, Jenny

Vandenhoeck & Ruprecht; Böhlau, 2024

ISBN 978-3-412-52670-2 | 2024-02-29 | 46 Musikwissenschaft

e-Medien: https://doi.org/10.7788/9783412526702

Buchcover

Innovationsmanagement? Frag doch einfach! klare Antworten aus erster Hand

Amelingmeyer, Jenny

UVK Verlag, 2023

ISBN 978-3-8252-6097-2 | 2024-02-26 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 325-Amel [verfügbar]

Buchcover

Insekten Überlebenskünstler auf sechs Beinen

Rigos, Alexandra

Tessloff, 2018

ISBN 978-3-7886-2108-7 | 2024-02-23 | 29 Zoologie

Bibliothekszentrum West: Lesesaal, N30717/30 [verfügbar]

Buchcover

Insolvenzrecht aktuell: Lösungen für die Praxis

Grazer Insolvenzrechtspraxis-Symposium Graz 2023 2.

Verlag Österreich, 2024

ISBN 978-3-7046-9353-2 | 2024-02-15 | 08 Recht

e-Medien: https://doi.org/10.33196/9783704693532

Buchcover

Instanzenzüge nach Art 94 Abs 2 B-VG im verfassungsrechtlichen Gesamtsystem

Greifeneder, Martin K.

MANZ'sche Verlags- und Universitätsbuchhandlung, 2024

ISBN 978-3-214-25351-6 | 2024-02-19 | 08 Recht

Fachbibliothek Recht: Bibliothek für Öffentliches Recht, Staats- und Verwaltungslehre, [verfügbar]

Buchcover

Integration durch Geschichté Werkstattberichte und Analysen zu den Orientierungskursen für Zugewanderte und Geflüchtete

V&R unipress, 2023

ISBN 978-3-7370-1427-4 | 2024-02-26 | 54 Geschichte


Beschreibung: Orientierungskurse für Geflüchtete beugen Antisemitismus nur unzureichend vor

e-Medien: https://doi.org/10.14220/9783737014274

Buchcover

Internationales Wirtschaftsrecht ein Studienbuch

Herdegen, Matthias

CH Beck, 2023

ISBN 978-3-406-79698-2 | 2024-02-22 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Finanzrecht, [verfügbar]

Buchcover

Interpretazione incrociata Uno studio tra modelli teorici e vissuti empirici

Loffredo, Martina

2024

2024-02-15 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: In dieser Masterarbeit wird das Konzept des Querdolmetschens untersucht, eine spezifische Form des Konferenzdolmetschens, bei der Dolmetscher/-innen. zwischen zwei Nicht-Muttersprachen agieren. Besonderes Augenmerk liegt auf den Erfahrungen von Studierenden und Lehrenden am Institut für Translationswissenschaft in Innsbruck und am Zentrum für Translationswissenschaft der Universität Wien. Diese Studie untersucht die linguistischen, kognitiven und dolmetschspezifischen Fähigkeiten, die für das Querdolmetschen notwendig sind, beleuchtet die dazugehörigen Herausforderungen und betrachtet Lehr- und Lernmethoden in diesem Bereich.br /Die Notwendigkeit spezifischer Ausbildungsprogramme und angepasster Lehrmethoden zur Bewältigung der besonderen Herausforderungen des Querdolmetschens wird herausgestellt. Es werden die verschiedenen theoretischen Modelle im Dolmetschen untersucht, mit einem Fokus auf den kognitiven Aufwand und die Bewältigungsstrategien, die für diese Art des Dolmetschens erforderlich sind. Die Arbeit bietet neue Einblicke in die Komplexität des Querdolmetschens und hebt die Bedeutung der professionellen Ausbildung in diesem speziellen Bereich der Dolmetschpraxis hervor.br /Im Rahmen der empirischen Phase der Masterarbeit fand eine umfassende Studie zu den Erfahrungen von Studierenden und Lehrenden im Bereich des Querdolmetschens statt. Hierbei wurden mittels Interviews qualitative Daten erhoben, um ein besseres Verständnis der erforderlichen Kompetenzen sowie der Herausforderungen zu gewinnen, mit denen Dolmetscher/-innen konfrontiert sind. Diese methodische Herangehensweise bot eine realitätsnahe und anwendungsorientierte Perspektive auf die Dynamik des Querdolmetschens im akademischen und beruflichen Kontext.br /Die vorliegende Masterarbeit trägt dazu bei, das Verständnis für diese anspruchsvolle Form des Dolmetschens zu vertiefen und unterstreicht die Wichtigkeit einer zielgerichteten und spezialisierten Ausbildung für Dolmetscher/-innen in diesem Bereich.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-144713

Buchcover

Intraspecific variability of leaf and root traits of Salix herbacea and Cassiope tetragona on a fertilization gradient in Subarctic Sweden

Kriegel, Valentin Paul Ventura

2023

2024-02-15 | 58 Fachlich nicht erfasste Objekte


Beschreibung: eng: Climate warming has been suggested to increase the mineralization of soil organic matter, thereby leading to increased nutrient availability in Arctic ecosystems, which are generally considered to be nutrient limited. In this study, the intraspecific responses of below- and aboveground plant traits of the species Salix herbacea and Cassiope tetragona to fertilization with N and P were measured in a glacier foreland in Subarctic Sweden. The effect of increased nutrient availability was put into the context of two scales of primary succession, large-scale succession induced by glacier retreat, and small-scale succession induced by frost heave inside of sorted circles. Furthermore, the response of plants to the treatment outside of sorted circles in the glacier foreland was compared to the response in sorted circles to include the effect of geomorphology. I hypothesized that chemical traits would respond more strongly to fertilization than morphological traits. Furthermore, I hypothesized that responses to the treatment would be stronger on earlier successional stages than on later ones and stronger inside of sorted circles than in the glacier foreland. Of the morphological traits, only LA (Leaf Area) was higher on fertilized plots regarding both species, whereas RDMC (Root Dry Matter Content) was only significantly lower in the case of Salix and no significant responses were found in the cases of LDMC (Leaf Dry Matter Content), SLA (Specific Leaf Area) and SRL (Specific Root Length). N and P contents were significantly higher, C:N ratios significantly lower on fertilized plots regarding both species. Leaf C content of C. tetragona and root C content of S. herbacea were significantly higher on fertilized plots. The effects of the successional gradients were mostly unsignificant or contradicting each other, most likely because an insufficient range of the gradient was covered by the samples. Plots outside of sorted circles had significantly lower soil water contents, which did not limit nutrient uptake as trait responses to the treatment were more pronounced outside of sorted circles than inside of them in several cases. In general, the influence of climate change on Arctic plants is very complex and a lot of factors must be included in future research to draw final conclusions.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-142291

Buchcover

Introduction to Chinese cursive script = Xing cao du ben

Wang, Fang-yü

Institute of Far Eastern Languages, 1958

ISBN 978-0-88710-033-8 | 2024-02-14 | 22 Außereuropäische Sprachen und Literaturen

Hauptbibliothek: Magazin HB, 742752 [verfügbar]

Buchcover

Isaiah and intertextuality Isaiah amid Israel's scriptures

Mohr Siebeck, 2024

ISBN 978-3-16-163234-1 | 2024-02-13 | 06 Religion, Theologie

e-Medien: https://doi.org/10.1628/978-3-16-163234-1

Buchcover

Islam Kreuzworträtsel der Islam in 30 Kreuzworträtseln

Genç, Mehmet Umut,,

Amazon Fulfillment, 2023

2024-02-12 | 06 Religion, Theologie

Fachbibliothek Theologie: Freihand, ITR 11-050 GENC [verfügbar]

Buchcover

Israel's Knesset members a comparative study of an undefined job

Rolef, Susan Hattis

Routledge Taylor & Francis Group, 2022

ISBN 978-1-03-204679-2 | 2024-02-16 | 09 Politik


Beschreibung: Taking Members of the Israeli Knesset (MKs) as a case study, this book offers a comparative analysis of the various roles performed by Members of Parliament (MPs) within the framework of their job in democracies around the world.Based on the author’s experience of working in and for the Knesset, from 1977 to 2010, this book questions the lack of a comprehensive job descrip-tion not only for MKs but also for similar roles in parliamentary democracies globally. The author finds that a serious perusal of materials dealing with the job’s various components – in the Israeli case, for example, basic laws, the Knesset Rules of Procedure, the Rules of Ethics for MKs, minutes of the Knesset Plenum and Committees and so forth ? presents an almost complete picture of the MK’s job that like pieces in a jigsaw puzzle merely need to be assembled together. Finding the job of MPs in general, and of MKs specif-ically, definable, this book argues that it ought to be defined considering the centrality of this role for a democracy’s functioning.This innovative book will not only prove useful for scholars of Israeli govern-ance and legislation but will also be of interest to scholars of parliamentarism and comparative legislative politics in general.

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 733-Role [entlehnt]

Buchcover

Ist es noch Selbstliebe oder schon Narzissmus? den weiblichen Narzissmus verstehen und überwinden

Wardetzki, Bärbel

Kösel, 2023

ISBN 978-3-466-34808-4 | 2024-02-09 | 05 Psychologie

Hauptbibliothek: Magazin HB, 742782 [entlehnt]

Buchcover

It’s all about emotions narratives of highly skilled migrants: a study of Swiss in Israel and Israelis in Switzerland

Oberlé, Hélène Mona

Vandenhoeck & Ruprecht; Böhlau Verlag, 2023

ISBN 978-3-412-52904-8 | 2024-02-27 | 54 Geschichte


Beschreibung: Abstract The study focuses on highly skilled migrants, specifically, Swiss in Israel and Israelis in Switzerland. The attention of the study lies on the significance of migration within (multi-sited) biographies. Focusing on twelve main protagonist, Hélène Mona Oberlé analyses and discusses the perceptions, interpretations, and varying uses of emotions in migration-narratives.Three main themes are presented: first, feelings of (non-)belonging to places and specific groups; second, past, present and future in the form of nostalgia, irritation and expectation; third, notions of “going abroad” as a feeling of accomplishment emerging within the narratives. Overall, the protagonists construct a self which is flexibly adapted to the empirical reality of globalization, experiences struggles and tensions yet creates meaningful connections to specific places and times through the use of various emotions.Die Studie thematisiert hochqualifizierte Schweizer:innen in Israel und Israelis in der Schweiz und fragt nach der Bedeutung von Emotionen in Migrationserzählungen und (mehrfach verorteten) Biografien. Hélène Mona Oberlé analysiert und diskutiert die Wahrnehmungen, Interpretationen und unterschiedlichen Emotionen, die in den Erzählungen von zwölf ausgewählten Protagonist:innen aufkommen. Dabei geht es insbesondere um drei Hauptthemen: Gefühle der (nicht-)Zugehörigkeit zu Orten und Gruppen; Narrative von Vergangenheit, Gegenwart und Zukunft in Verbindung mit Gefühlen von Nostalgie, Irritation und Erwartung; das „ins Ausland gehen“ als Erfolgsgefühl. Die Protagonist:innen konstruieren mit ihren Erzählungen ein flexibles Selbst, das sich an die Herausforderungen und Spannungen einer globalisierten Welt anpasst und gleichzeitig durch Emotionen bedeutsame Verbindungen zu Orten und Zeitpunkten erschafft.

e-Medien: https://doi.org/10.7788/9783412529048

Buchcover

J. von Staudingers Kommentar zum Bürgerlichen Gesetzbuch mit Einführungstext und Nebengesetzen

De Gruyter; ottoschmidt, 2024

ISBN 978-3-8059-1359-1 | 2024-02-28 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Je länger wir schweigen, desto mehr Mut werden wir brauchen wie gefährlich die AfD wirklich is

Cremer, Hendrik.

Berlin Verlag, 2024

ISBN 978-3-8270-1508-2 | 2024-02-14 | 09 Politik


Beschreibung: Die Gefahr, die von der AfD ausgeht, wird im öffentlichen Diskurs nicht abgebildet. Die Partei wird verharmlost, indem sie etwa als »rechtspopulistisch« bezeichnet wird. Dabei hat sie sich längst zu einer rechtsextremen Partei entwickelt. Ihre Gewaltbereitschaft wird regelmäßig ausgespart. Zugleich erzielt sie hohe Zustimmungswerte, und Vertreter:innen demokratischer Parteien grenzen sich nicht genügend von ihr ab. Cremer zeigt eine Entwicklung, die angesichts der deutschen Geschichte lange nicht für möglich gehalten wurde. Die Strategie der AfD droht aufzugehen, wenn sich der Umgang mit ihr nicht grundlegend wandelt. Ein fundiertes Aufklärungsstück, um die Dimension des Angriffs auf die freiheitliche rechtsstaatliche Demokratie zu erkennen. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 752-Crem [verfügbar]

Buchcover

Jil Sander eine Annäherung

Wiesner, Maria.

HarperCollins, 2023

ISBN 978-3-365-00461-6 | 2024-02-26 | 45 Kunst

Hauptbibliothek: Freihand, 600/LH 79067 S214 W6 [verfügbar]

Buchcover

Jüdische Lebenswelten im Osmanischen Reich

De Gruyter, 2024

2024-02-13 | 54 Geschichte

e-Medien: BibSearch

Buchcover

Jurisdiction in investment treaty arbitration IAI conference Paris

Juris, 2018

ISBN 978-1-944825-17-1 | 2024-02-20 | 08 Recht

Fachbibliothek Recht: Bibliothek für Völkerrecht, [verfügbar]

Buchcover

Kämpfer auf dem Schlachtfeld – Kämpfer in den Texten Schlachtenschilderungen in den historiografischen Quellen des 14. und beginnenden 15. Jahrhunderts

Wiedmaier, Helen

Mainz University Press; V&R unipress, 2023

ISBN 978-3-7370-1668-1 | 2024-02-26 | 54 Geschichte


Beschreibung: Zusammenfassung Anhand der Schlacht am Morgarten (1315) sowie der Schlachten von Gammelsdorf (1313), Mühldorf (1322) und Sempach (1389) untersucht Helen Wiedmaier exemplarisch, wie in der spätmittelalterlichen Historiographie Schlachten beschrieben und Männer als Kämpfer konstruiert wurden. Dafür werden die Schlachtenschilderungen in den Chroniken als Erzählungen verstanden und mittels narratologischer Analyseinstrumente untersucht. Die gewählten Schlachten bieten sich für eine solche Untersuchung aufgrund ihrer reichhaltigen Überlieferung an, da in allen Fällen die Perspektive der Sieger und Besiegten weitergegeben wurde, was die Möglichkeit bietet, unterschiedliche Intentionen und deren Umsetzung als Erzählungen zu untersuchen und zu vergleichen.

e-Medien: https://doi.org/10.14220/9783737016681

Buchcover

Kein Frieden für Palästina der lange Krieg gegen Gaza, Besatzung und Widerstand

Baumgarten, Helga

Promedia, 2023

ISBN 978-3-85371-496-6 | 2024-02-12 | 09 Politik


Beschreibung: Die israelische Besatzung mit ihrer Siedlungs- und Vertreibungspolitik, der Krieg der israelischen Armee gegen den Gaza-Streifen, der seit 2007 unter einer völkerrechtswidrigen Blockade leidet, und der Widerstand der PalästinenserInnen dagegen dominieren in zeitlich immer kürzer werdenden Abständen die Schlagzeilen der internationalen Presse. Noch nie hat die palästinensische Bevölkerung so viel internationale Solidarität erfahren, von den USA (bis hinein in den Kongress) über Europa bis in die arabische Welt und nach Ostasien. Das Buch der in Jerusalem ansässigen deutschen Politikwissenschaftlerin Helga Baumgarten will den interessierten LeserInnen die Hintergründe für den längsten geopolitischen Konflikt unseres Zeitalters näherbringen, um ihn besser verstehen und einordnen zu können. Mit einem historisch-analytischen Rückblick ab 1948, dem Jahr der Staatsgründung Israels und dem Beginn der palästinensischen Tragödie, der Nakba, über die Intifada bis zum Scheitern der als Friedensprozess gefeierten Osloer Verhandlungen werden die wichtigsten Stationen der Entwicklungen in Israel/Palästina kritisch untersucht. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 799-Baum|b [verfügbar]

Buchcover

Ketzer und Heiliger : das Bild des Johannes Hus zwischen Reformation und Aufklärung

Thomsen, Eike

Vandenhoeck & Ruprecht, Dissertation, Universität Leipzig, 2022 - Volltext: https://doi.org/10.13109/9783666573545

ISBN 978-3-666-57354-5 | 2024-03-01 | 06 Religion, Theologie

e-Medien: https://doi.org/10.13109/9783666573545

Buchcover

KFG Kraftfahrgesetz

Grubmann, Michael

Verlag Österreich, 2023

ISBN 978-3-7046-9286-3 | 2024-02-14 | 08 Recht

e-Medien: https://doi.org/10.33196/9783704692863

Buchcover

Kinder und die großen Antworten generationsübergreifende Impulse für Schule und Gemeinde

Büttner, Gerhard

Calwer Verlag, 2019

ISBN 978-3-7668-4457-6 | 2024-02-07 | 58 Fachlich nicht erfasste Objekte

Fachbibliothek Theologie: Freihand, RP 05-060 BÜTT [verfügbar]

Buchcover

Kindeswohl und Elternschaft Schwerpunkt Eltern-Kind-Zuordnung in alternativen und grenzüberschreitenden Familien

Buchstätter, Elmar

Jan Sramek Verlag KG, 2023

ISBN 978-3-7097-0345-8 | 2024-02-14 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Klartext Klima! Zusammenhänge verstehen, loslegen und effektiv handeln

Schurmann, Sara

Brandstätter, 2022

ISBN 978-3-7106-0598-7 | 2024-02-08 | 10 Wirtschafts- und Sozialwissenschaften allgemein


Beschreibung: Der Klimawandel ist real und bedrohlich, das stellt kaum noch jemand ernsthaft in Frage. Wie akut die Klimakrise wirklich ist und wie stark sie unsere Leben schon in den kommenden Jahrzehnten betreffen wird, das ist allerdings nur wenigen richtig bewusst. Auch Sara Schurmann hat lange verdrängt, wie wenig Zeit uns bleibt, um die Katastrophe abzuwenden. Doch dann begann sie zu recherchieren, und ihr wurde klar: Es gibt noch so viel, das wir retten können – also tun wir es! Klar, kompakt, deutlich: Das Buch, das Durchblick schafft Dieses Buch rüttelt auf und motiviert. Es erklärt unsere Situation und analysiert, warum bisher nicht ausreichend gehandelt wird. Außerdem zeigt es, welche Lösungen realistisch und wirkungsvoll sind, und liefert Ideen, wie sich jede:r Einzelne von uns effektiv für einen echten Wandel einsetzen kann. Denn: Wer die Zusammenhänge versteht, wird handeln. Wir tragen Verantwortung Das Material für den Einbandüberzug ist zu 100% aus recyceltem Papier. Der Inhalt dieses Buchs wurde auf hochwertigem, FSC©-zertifizierten Naturpapier gedruckt. Dieses Papier trägt darüber hinaus ein Zertifikat auf dem Cradle to Cradle Certified® Silver Level. Cradle to Cradle® zielt auf ein ökologisch verträgliches Wirtschaften in sich wiederholenden Rohstoff-Produkt-Kreisläufen ab. Für die Druckproduktion und Endfertigung wurde auf umweltfreundliche, ressourcenschonende und schadstofffreie Produktionsweisen und Materialien geachtet. Die Druckerei ist FSC©-zertifiziert und bezieht ihre Energie zu 100% aus umweltfreundlichen, erneuerbaren Quellen. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 263-Schu [verfügbar]

Buchcover

Klassismus

Gamper, Markus

transcript Verlag, 2024

ISBN 978-3-8252-5927-3 | 2024-02-19 | 11 Soziologie und Kulturwissenschaften

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Klimaschutzrecht

Verlag Österreich, 2023

ISBN 978-3-7046-9261-0 | 2024-02-14 | 08 Recht


Beschreibung: Dieses Handbuch bietet eine umfassende, fundierte Aufbereitung der Querschnittsmaterie Klimaschutzrecht. In 21 Kapiteln behandeln Autor*innen aus Wissenschaft und Praxis alle wesentlichen Bereiche dieses dynamischen Rechtsgebiets: von den völker-, unions- und verfassungsrechtlichen Grundlagen des Klimaschutzes über Emissionshandel, Energieeffizienz und erneuerbare Energien bis hin zu Klimaklagen, Zivilgesellschaft und Zivilrecht. Als erste derartige Gesamtdarstellung in der österreichischen Rechtsliteratur wendet sich dieses Handbuch an alle Rechtsanwender*innen, Wissenschaftler*innen und Studierenden, die sich einen Überblick über die Rolle des Klimaschutzes im Recht verschaffen oder ihr einschlägiges Wissen vertiefen wollen.

e-Medien: https://doi.org/10.33196/9783704692610

Buchcover

Klimaungerechtigkeit was die Klimakatastrophe mit Kapitalismus, Rassismus und Sexismus zu tun hat

Otto, Friederike

Ullstein, 2023

ISBN 978-3-550-20244-5 | 2024-02-05 | 32 Meteorologie und Geophysik

Hauptbibliothek: Freihand, 600/MK 8900 O91 [verfügbar]

Buchcover

Knochenlese Roman

Reichs, Kathy

Blanvalet, 2004

ISBN 978-3-442-36161-8 | 2024-02-07 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742762 [verfügbar]

Buchcover

Knochenpfade : Roman

Kava, Alex

Cora-Verl, 2011

ISBN 978-3-89941-834-7 | 2024-02-22 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742811 [verfügbar]

Buchcover

Köln

Beintmann, Cord

Reclam, 2023

ISBN 978-3-15-014411-4 | 2024-02-19 | 42 Architektur

Zentraldepot: Externmagazin I, T26031 [verfügbar]

Buchcover

Kollektiver Freizeitpark oder Burnout-Gesellschaft wie überlastet ist der moderne Mensch?

Wirsching, Andreas

Picus Verlag, 2016

ISBN 978-3-7117-3005-3 | 2024-02-05 | 11 Soziologie und Kulturwissenschaften

Hauptbibliothek: Magazin HB, 742770 [verfügbar]

Buchcover

Konsumentenschutzgesetz Text, Materialien, Judikatur

proLIBRISat, 2023

ISBN 978-3-99099-609-6 | 2024-02-13 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Kontinuität – Stabilität – Krise Antoninus Pius und die untrüglichen Zeichen von Veränderung im 2. Jh. n. Chr.

Vandenhoeck & Ruprecht; Böhlau Verlag, 2023

ISBN 978-3-205-21674-2 | 2024-02-27 | 54 Geschichte


Beschreibung: Im Mittelpunkt dieser Publikation steht die Betrachtung des römischen Kaisers Antoninus Pius aus unterschiedlichen Blickwinkeln. Der innovative Aspekt liegt in der Vielfalt der Themen, die Kommunikationsstrategien, Konzepte und eine Programmatik in der Repräsentation des Kaisers und seiner Familie behandeln.

e-Medien: https://doi.org/10.7767/9783205216742

Buchcover

Korruption, Amtsmissbrauch und Untreue Grundlagen, Definitionen und Beispiele zu den §§ 153, 302, 304 bis 311 StGB sowie weitere praxisrelevante Tatbestände im Korruptionsbereich

Marek, Eva

MANZ'sche Verlags- und Universitätsbuchhandlung, 2023

ISBN 978-3-214-25420-9 | 2024-02-15 | 08 Recht

Fachbibliothek Recht: Bibliothek für Strafrecht, Strafprozessrecht und Kriminologie, [verfügbar]

Buchcover

Kosmologische Strukturbildung von der Quantenfluktuation zur Galaxie

Hetznecker, Helmut

Imprint Spektrum Akademischer Verlag; Spektrum Akademischer Verlag, 2009

ISBN 978-3-8274-2155-5 | 2024-02-20 | 58 Fachlich nicht erfasste Objekte

e-Medien: BibSearch

Buchcover

Kreativität im Unternehmen Anregungen, Mehrwert, Praxisbeispiele : ein Handbuch konkret erläutert am Beispiel der DATEV eG

Häfner, Johannes

Versus; Vahlen, 2024

ISBN 978-3-03909-336-6 | 2024-02-20 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 325-Häfn [verfügbar]

Buchcover

Krieg, Hunger, Pest und Glaubenszwist München im Dreißigjährigen Krieg

Heimers, Manfred Peter

Buchendorfer Verl, 1998

ISBN 978-3-927984-84-4 | 2024-01-30 | 54 Geschichte

Hauptbibliothek: Magazin HB, 348613 [verfügbar]

Buchcover

Kriminalität Anforderungen an die Soziale Arbeit

Lindenberg, Michael

Kohlhammer Verlag, 2024

ISBN 978-3-17-037656-4 | 2024-02-19 | 07 Pädagogik

e-Medien: https://doi.org/10.17433/978-3-17-037656-4

Buchcover

Kryptowerte in der Insolvenz technische Grundlagen - Privatrecht - Exekutions- und Insolvenzrecht

Weidinger, Tobias

Verlag Österreich, 2023

ISBN 978-3-7046-9294-8 | 2024-02-14 | 08 Recht

e-Medien: https://doi.org/10.33196/9783704692948

Buchcover

Künstliche Intelligenz im Wirtschaftsinformatikunterricht Interviewstudie zum Implementierungsstand an Handelsakademien

Wibmer, Isabell Rosa

2023

2024-02-29 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Die Künstliche Intelligenz findet zunehmend Eingang in der Bildungslandschaft. Dies wird vor allem durch die laufenden Entwicklungen der Künstliche Intelligenz vorangetrieben. Daraus ergibt sich das Forschungsinteresse für die vorliegende Masterarbeit in der Darstellung der derzeitigen didaktischen Implementierung der Künstliche Intelligenz im Wirtschaftsinformatikunterricht. Aufgrund der Aktualität der schulischen Diskussion zur Implementierung der Künstlichen Intelligenz im Unterricht ist zudem die persönliche Bewertung der kaufmännischen Lehrpersonen in Bezug auf derzeitigen bzw. zukünftigen Einsatz der Künstlichen Intelligenz von hoher Relevanz. Aus dem genannten Forschungsinteresse ergibt sich die folgende Forschungsfrage:br /Wie sieht die derzeitige Implementierung von KI im Wirtschaftsinformatikunterricht an der Handelsakademie aus und wie bewerten die Wirtschaftspädagog:innen den (zukünftigen) Einsatz von KI in ihrem Unterricht?br /Für die Beantwortung der Forschungsfrage wird zum einen eine Literaturrecherche zur lerntheoretischen Didaktik, der Künstlichen Intelligenz und deren Integrationspotenzial in der Bildungswelt durchgeführt. Zum anderen wird mithilfe einer Interviewstudie mit elf kaufmännischen Lehrpersonen von Handelsakademien aus unterschiedlichen Schulstandorten in Tirol und Vorarlberg versucht, die notwendigen Informationen zu erforschen, um die Forschungsfrage zu beantworten. Bei der Wahl der Lehrpersonen wird darauf geachtet, dass sie das fokussierte Unterrichtsfach Wirtschaftsinformatik lehren. br /Die Auswertung der Interviewstudie stellt klar, dass derzeit noch keine relevanten didaktischen Implementierungen der Künstlichen Intelligenz im Wirtschaftsinformatikunterricht erfolgen. Hinsichtlich der persönlichen Einschätzung der Lehrenden konnte herausgefunden werden, dass der Großteil von einer zukünftigen Implementierung der Künstlichen Intelligenz überzeugt ist. Die Lehrkräfte erwarten dabei zentrale Veränderungen in der Leistungsbeurteilung und bei den Prüfungsmodalitäten. Die zukünftigen didaktischen Veränderungen sind jedoch schwierig einzuschätzen, da sie stark von den Entwicklungen der Künstlichen Intelligenz abhängig sind.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-143062

Buchcover

Künstliche Intelligenz werden wir alle vernichtet?

Meyer, Mario

Asteria Media SL, 10. Mai 2023

2024-02-01 | 24 Informatik

Hauptbibliothek: Magazin HB, 742774 [verfügbar]

Buchcover

Küssen : eine berührende Kommunikationsart

Haarkötter, Hektor

S FISCHER, 2024

ISBN 978-3-10-397433-1 | 2024-02-06 | 02 Publizistik und Kommunikation


Beschreibung: In seinem Streifzug durch Geschichte und Theorie des Küssens fragt Hektor Haarkötter: Was macht das Küssen eigentlich aus? Warum küsst man nicht überall auf der Welt, sondern nur in bestimmten Kulturen? Was verbindet Liebeskuss, Bruderkuss, Abschiedskuss, Filmkuss und den Gutenachtkuss? Haarkötters Antwort: Küssen ist ein Akt der Kommunikation. Das zeigt er u.a. am naturwissenschaftlichen Wissen über den Kuss, an seiner Geschichte von der Antike bis heute, am Kuss in Film, Literatur, Märchen und der Kunst, an Fragen wie: Ist küssen privat? Was ist der Unterschied zwischen Sex und Küssen? Warum küsst man Gegenstände wie z.B. Ringé Und was hat die Bussi-Bussi-Gesellschaft mit all dem zu tun? Küssen, das zeigt Haarkötter so augenzwinkernd wie informiert, ist eine ganz eigentümliche Art der Kommunikation. Und es könnte sein, dass ihre Zeit zu Ende geht. Doch wie sieht eine Welt aus, in der nicht mehr geküsst wird? (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 987-Haar [verfügbar]

Buchcover

Kulturaustausch im ländlichen Hausbau inneralpin und transalpin ; Berichte über die Tagung der Regionalgruppe Alpen in Schwyz, 29. Juni - 1. Juli 2002

Michael Imhof Verl, 2003

ISBN 978-3-935590-99-0 | 2024-02-12 | 42 Architektur

Hauptbibliothek: Magazin HB, 675738 [verfügbar]

Buchcover

L'amministrazione delle società profili e problemi

Giuffrè Francis Lefebvre, 2023

ISBN 978-88-288-5317-6 | 2024-02-21 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

La deriva dell'autonomia differenziata e la Sardegnä

Isolapalma, 2023

ISBN 978-88-946694-1-1 | 2024-02-15 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Öffentliches Recht, [verfügbar]

Buchcover

La disciplina del mercato dei capitali

Annunziata, Filippo

Giappichelli, 2023

2024-02-20 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

La monetizzazione dei dati personali

Giuffrè Francis Lefebvre, 2024

ISBN 978-88-288-4394-8 | 2024-02-22 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

La pubblicazione dei testamenti olografi e dei testamenti segreti

Laghi, Pasquale

Giuffrè Francis Lefebvre, 2023

ISBN 978-88-288-5978-9 | 2024-02-20 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

La responsabilità medica

Emiliozzi, Enrico Antonio

Giuffrè Francis Lefebvre, 2023

ISBN 978-88-288-4031-2 | 2024-02-22 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

La sovranità fiscale nazionale tra erosione e consolidamento

Amatucci, Fabrizio

G Giappichelli, 2022

ISBN 978-88-921-2331-1 | 2024-02-16 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Finanzrecht, [verfügbar]

Buchcover

Labyrinth & Archi/Textur ein Gespräch

treppe b, 2023

ISBN 978-3-96551-023-4 | 2024-01-30 | 42 Architektur

Bibliothekszentrum West: Freihand, 800/ZH 3100 R718 [verfügbar]

Buchcover

Lachen lässt unser Glück aufblühen

Hörtenhuber, Kurt

werteArt, 2022

ISBN 978-3-903175-59-4 | 2024-02-19 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 355448 [verfügbar]

Buchcover

Languages of national socialism sources, perspectives, methods

EUT Edizioni Università di Trieste, 2023

ISBN 978-88-5511-404-2 | 2024-02-23 | 17 Germanistik, Skandinavistik, Niederlandistik

Hauptbibliothek: Magazin HB, 355463 [verfügbar]

Buchcover

Langue idéale, langue réelle description et normalisation des langues classiques du IIIe s. av. J.-C. au XIIe s. de notre ère

Brepols, 2023

ISBN 978-2-503-60901-0 | 2024-02-07 | 20 Klassische Philologie

Fachbibliothek Theologie: Freihand, ALLG 10-008 015 [verfügbar]

Buchcover

Lavoro digitale

Giappichelli, 2022

ISBN 978-88-921-2235-2 | 2024-02-22 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Le ‘gin boom’ au Québec et en Écosse : les discours des gins québécois et écossais sur les sites web

Proulx, Jessy

Masterarbeit, Universität Innsbruck, 2023 - Volltext: BibSearch

2024-02-26 | 18 Romanistik

Hauptbibliothek: Magazin HB, DG67801 [verfügbar]

Buchcover

Le assicurazioni

Berti De Marinis, Giovanni

Giuffrè Francis Lefebvre, 2023

ISBN 978-88-288-5060-1 | 2024-02-23 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Le détail révélateur

Aumont, Jacques

Leo S Olschki, 2023

ISBN 978-88-222-6866-2 | 2024-02-16 | 48 Film, Rundfunk, Fernsehen

Hauptbibliothek: Magazin HB, 355469 [verfügbar]

Buchcover

Le jeune homme de sable roman

Sassine, Williams

Présence africaine, 1997

ISBN 978-2-7087-0617-0 | 2024-01-29 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 355437 [verfügbar]

Buchcover

Le Nazioni Unite

Conforti, Benedetto

CEDAM; Wolters Kluwer, 2023

2024-02-16 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Finanzrecht, [verfügbar]

Buchcover

Le pape françois et la réforme liturgique

CLV Centro Liturgico Vincenziano, 2023

ISBN 978-88-7367-324-8 | 2024-02-07 | 06 Religion, Theologie

Fachbibliothek Theologie: Freihand, 210-W5.1 CARD [verfügbar]

Buchcover

Le profonde radici disegni di Ettore Sottsass Sr. : 1911 - 1929

Scripta, 2013

ISBN 978-88-96162-65-1 | 2024-02-07 | 42 Architektur

Zentraldepot: Externmagazin I, T454533 [verfügbar]

Buchcover

Leben der berühmtesten Maler, Bildhauer und Baumeister von Cimabue bis zum Jahre 1567

Vasari, Giorgio

Marixverl, 2010

ISBN 978-3-86539-224-4 | 2024-02-08 | 45 Kunst

Hauptbibliothek: Magazin HB, 388621 [verfügbar]

Buchcover

Legal English for business Fachbegriffe, Formulierungshilfen, Beispielsätze : Deutsch - Englisch

Helbing Lichtenhahn; CH Beck; LexisNexis, 2022

ISBN 978-3-7007-9989-4 | 2024-02-13 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Lehrbuch Organisationspsychologie

Hogrefe, 2019

ISBN 978-3-456-95997-9 | 2024-02-20 | 58 Fachlich nicht erfasste Objekte

e-Medien: https://doi.org/10.1024/85997-000

Buchcover

Leidenschaft für die Welt wider die Gottvergessenheit

Zulehner, Paul

Patmos Verlag, 2023

ISBN 978-3-8436-1492-4 | 2024-02-07 | 06 Religion, Theologie

Fachbibliothek Theologie: Freihand, PA 03-050 ZULE [verfügbar]

Buchcover

Lern- und Übungssystem Bürgerliches Recht der Prüfungsstoff in Checklisten

Linde, 2024

ISBN 978-3-7073-4590-2 | 2024-02-12 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Lernen beim Arbeiten Handreichung für die Praxis

Hacker, Winfried,,

DCV, Januar 2024

ISBN 978-3-943488-81-4 | 2024-02-26 | 07 Pädagogik

Hauptbibliothek: Magazin HB, 355460 [reserviert]

Buchcover

Lexikon der Wiener Gemeindebauten Namen, Denkmäler, Sehenswürdigkeiten

Autengruber, Peter

Wundergarten, 2023

ISBN 978-3-903070-20-2 | 2024-01-30 | 42 Architektur

Bibliothekszentrum West: Freihand, 800/ZH 4920 A939 L6 [verfügbar]

Buchcover

Licht und Atome Wunderwelt der Quanten

Baur, Manfred

Tessloff, 2020

ISBN 978-3-7886-7693-3 | 2024-02-22 | 33 Physik

Bibliothekszentrum West: Lesesaal, N30721 [verfügbar]

Buchcover

Liebe

Fischer, Veronika

Kremayr & Scheriau, 2024

ISBN 978-3-218-01414-4 | 2024-02-21 | 05 Psychologie

Hauptbibliothek: Magazin HB, 742832 [verfügbar]

Buchcover

Lieferkettenverantwortlichkeit: wieso - woher - wohin soll/kann an unserem Wesen die Welt genesen?

MANZ'sche Verlags- und Universitätsbuchhandlung, 2023

ISBN 978-3-214-25489-6 | 2024-02-14 | 08 Recht

Fachbibliothek Recht: Bibliothek für Strafrecht, Strafprozessrecht und Kriminologie, [verfügbar]

Buchcover

Living to the max opulent homes and maximalist interiors

gestalten, 2023

ISBN 978-3-96704-090-6 | 2024-02-12 | 42 Architektur

Bibliothekszentrum West: Freihand, 800/ZH 8100 K63 L7 [verfügbar]

Buchcover

Loslassen & dranbleiben wie wir Veränderungen mutig begegnen

Wardetzki, Bärbel

Kösel, 2020

ISBN 978-3-466-34703-2 | 2024-02-09 | 05 Psychologie

Hauptbibliothek: Magazin HB, 742783 [verfügbar]

Buchcover

Love, you ein Buch für dich

Spellmeier, Kai.

LYX, 2023

ISBN 978-3-7363-1890-8 | 2024-02-21 | 11 Soziologie und Kulturwissenschaften

Hauptbibliothek: Freihand, 600/MS 2870 S743 [verfügbar]

Buchcover

Love's labor essays on women, equality and dependency

Kittay, Eva Feder

Routledge Taylor & Francis Group, 2020

ISBN 978-1-138-08992-1 | 2024-02-15 | 08 Recht


Beschreibung: This new edition of Eva Feder Kittay's feminist classic, Love's Labors, explores how theories of justice and morality must be reconfigured when intersecting with care and dependency, and the failure of policy towards women who engage in care work. The work is hailed as a major contribution to the development of an ethics of care. Where society is viewed as an association of equal and autonomous persons, the work of caring for dependents figure neither in political theory nor in social policy. While some women have made many gains, equality continues to elude many others, as in large measure, social institutions fail to take into account the dependency of childhood, illness, disability and frail old age and fail to adequately support those who care for dependents. Using a narrative of her experiences caring for her disabled daughter, she discusses the relevance of her analysis of dependency to significant cognitive disability. Eva Feder Kittay explores the significance of dependency work by analyzing John Rawls' influential liberal theory, and two examples of public policy--welfare reform and family leave--to show how theory and policy fail women when they miss the centrality of dependency to issues of justice. This second edition has updated material on care workers, her adult disabled daughter and key changes in welfare reform. Using a mix of personal reflection and political argument, this new edition of a classic text will continue to be an innovative and influential contribution to the debate on searching for greater equality and justice for women. Love's Labors has spoken to audiences around the world and has had an impact on readers from many countries and over many disciplines: philosophy, sociology, disability studies, nursing. It has been required and supplementary reading on many undergraduate courses on Ethics, Feminist Ethics, Gender and Religious Ethics, Political Theory, Bioethics and Disability Studies. It has been translated into Italian, Japanese and Korean--

Fachbibliothek Recht: Theorie und Zukunft des Rechts, [verfügbar]

Buchcover

Ludwig Wittgenstein : Wiener Ausgabe

Wittgenstein, Ludwig

Vittorio Klostermann, 2024

ISBN 978-3-465-03502-2 | 2024-02-19 | 04 Philosophie

Hauptbibliothek: Freihand, 600/CI 5001 W64.993-10,3 [verfügbar]

Buchcover

Machine readable Me the hidden ways tech shapes our identities

Rahman, Zara

404 Inklings, 2023

ISBN 978-1-912489-82-4 | 2024-02-20 | 11 Soziologie und Kulturwissenschaften

Fachbibliothek Recht: Theorie und Zukunft des Rechts, [verfügbar]

Buchcover

Mad world : the politics of mental health

Frazer-Carroll, Micha.

Pluto Press, 2023

ISBN 978-0-7453-4671-7 | 2024-02-21 | 11 Soziologie und Kulturwissenschaften


Beschreibung: Mental health is a political issue, but we often discuss it as a personal one. How is the current mental health crisis connected to capitalism, racism and other social issues? In a different world, how might we transform the ways that we think about mental health, diagnosis and treatment? These are some of the big questions Micha Frazer-Carroll asks as she reveals mental health to be an urgent political concern that needs deeper understanding beyond today''s ''awareness-raising'' campaigns. Exploring the history of asylums and psychiatry; the relationship between disability justice, queer liberation and mental health; art and creativity; prisons and abolition; and alternative models of care; Mad World is a radical and hopeful antidote to pathologisation, gatekeeping and the policing of imagination. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 660-Fraz [verfügbar]

Buchcover

Maklerrecht Österreich Praxiskommentar zu MaklerG und ImmobilienmaklerVO idF des Maklergesetz-Änderungsgesetzes

Knittl, Carl

Edition ÖVI Immobilienakademie, 2023

ISBN 978-3-902266-35-4 | 2024-02-14 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Manio Manilio, Marco Giumio Bruto, Publio Mucio Scevola qvi fvndavervnt ivs civile

Barbati, Stefano

L'Erma di Bretschneider, 2022

ISBN 978-88-913-2654-6 | 2024-02-28 | 08 Recht

Fachbibliothek Recht: Bibliothek für Römisches Recht, [verfügbar]

Buchcover

Manual de lengua española

García Macho, María Lourdes.

Editorial Universitaria Ramón Areces, 2023

ISBN 978-84-9961-444-1 | 2024-02-22 | 18 Romanistik

Hauptbibliothek: Freihand, 600/IM 1600 G216 [verfügbar]

Buchcover

Manuale di diritto civile

Caringella, Francesco

Dike Giuridica, 2023

ISBN 978-88-582-1458-9 | 2024-02-22 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Manuale di diritto civile

Paladini, Mauro

Giuffrè Francis Lefebvre, 2023

ISBN 978-88-288-4923-0 | 2024-02-21 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Manuale di diritto commerciale

Ferri, Giuseppe D.

Utet Giuridica, 2023

ISBN 978-88-598-2585-2 | 2024-02-23 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Manuali notarili

Genghini, Lodovico

CEDAM, 2023

ISBN 978-88-13-38331-2 | 2024-02-22 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Marketing for hospitality and tourism

Kotler, Philip

Pearson, 2022

ISBN 978-1-292-36351-6 | 2024-02-20 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: MCI-III, Weiherburgg. 8, 553-Kotl|c [verfügbar]

Buchcover

Marketing for tourism, hospitality & events a global & digital approach

Hudson, Simon.

Sage, 2024

ISBN 978-1-5296-2807-4 | 2024-02-15 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 553-Huds|b [verfügbar]

Buchcover

Marketing für Unternehmensberatungen B2B-Marketing im digitalen Wandel

Lippold, Dirk

De Gruyter Oldenbourg, 2024

ISBN 978-3-11-137449-9 | 2024-02-12 | 13 Betriebswirtschaft


Beschreibung: Vor dem Hintergrund des digitalen Wandels haben sich auch die Markt- und Wettbewerbsbedingungen der Beratungsunternehmen verändert. Eine Branche, deren Wurzeln zumeist bei Technikern und Tüftlern zu suchen sind, steht vor der Herausforderung, unter den veränderten Rahmenbedingungen erfolgversprechende und schlüssige Marketing-Konzepte zu entwickeln. Das Buch verfolgt das Ziel, ein Vorgehensmodell für den Vermarktungsprozess von Beratungsleistungen zu entwerfen. Es liefert eine phasenbezogene Darstellung der Vermarktung, die dem Management von Unternehmensberatungen Ansatzpunkte bietet, um die einzelnen Elemente der Marketing-Gleichung zu optimieren. (https://www.buchhandel.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 472-Lipp|b [verfügbar]

Buchcover

Masswerk Architekten

Masswerk Architekten

Quart, 2023

ISBN 978-3-03761-289-7 | 2024-02-14 | 42 Architektur


Beschreibung: Benedikt Rigling, René Bosshard und Matthias Baumann sind die Gründer des seit 2003 in Luzern und seit 2008 auch in Zürich domizilierten Büros Masswerk Architekten. Seither sind neben Wohnbauten eine Reihe von öffentlichen Gebäuden – insbesondere Schulhäuser, Alterszentren und Werkhöfe – entstanden, die sich durch ein breites architektonisches Repertoire und eine sorgfältige Entwurfsarbeit auszeichnen. Zwei Wohnhäuser inmitten eines Stadtparks in Luzern wirken in ihren reduzierten Baukörpern skulptural, ihre Grundrisse sind intelligent und selbstverständlich in die Baukörper eingepasst. Die städtebaulich bedeutsame Anlage Baufeld G an der Europaallee in Zürich ist mit ihren rhythmisierten Fassaden unaufdringlich ins Stadtbild eingeschrieben. Und das 2021 fertiggestellte Sekundarstufenzentrum Burghalde in Baden bietet in einer historischen Parkanlage mit geschützter Bausubstanz ein Raumangebot für 1000 Schülerinnen und Schüler. Benedikt Rigling, René Bosshard and Matthias Baumann are the founders of Masswerk Architekten, which has been based in Lucerne since 2003 and in Zurich since 2008. In addition to residential buildings, a number of public buildings have been created over the years – in particular school buildings, retirement centres and municipal facilities – which are characterised by a broad architectural repertoire and meticulous design work. Two residential buildings in the middle of a city park in Lucerne appear sculptural in their reduced structures, with floor plans fitted intelligently and naturally into the building volumes. The Baufeld G complex on Europaallee in Zurich, a significant urban development, inscribes itself unobtrusively in the cityscape with its rhythmic façades. To be completed in 2021, the Burghalde secondary school centre in Baden will accommodate 1,000 pupils in a historic park setting with protected buildings.

Zentraldepot: Externmagazin I, T173384 [verfügbar]

Buchcover

Mathe-Basics für Data Scientists : lineare Algebra, Statistik und Wahrscheinlichkeitsrechnung für die Datenanalyse

Nield, Thomas

O'Reilly®, 2024

ISBN 978-3-96009-215-5 | 2024-02-23 | 23 Mathematik, Statistik

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 901-Niel [verfügbar]

Buchcover

Mediale Gewaltdarstellung als Mittel zur Gesellschaftskritik : eine Analyse am Beispiel der Serie Squid Game

Bamberger, Jana

Masterarbeit, Universität Innsbruck, 2022 - Volltext: BibSearch

2024-02-26 | 48 Film, Rundfunk, Fernsehen

Hauptbibliothek: Magazin HB, DG67799 [verfügbar]

Buchcover

Medienkritik ist links warum wir eine medienkritische Linke brauchen

Meisner, Lukas.

Das Neue Berlin, 2023

ISBN 978-3-360-02758-0 | 2024-02-16 | 02 Publizistik und Kommunikation

Hauptbibliothek: Freihand, 600/AP 13850 M515 [verfügbar]

Buchcover

Medizinische "Wundermittel" und Betrug

Künk, Tobias

2024

2024-02-15 | 58 Fachlich nicht erfasste Objekte

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-145064

Buchcover

Meine kleine Lyrikreihe Bände 1-40 aus den Jahren 1980 bis 2020

Gesellschaft der Lyrikfreunde, 2021

2024-02-08 | 56 Belletristik und Spielfilme

Brenner-Archiv: Bibliothek, III-4316 [verfügbar]

Buchcover

Memento pratico famiglia e successioni

Giuffrè Francis Lefebvre, 2023

ISBN 978-88-288-5038-0 | 2024-02-23 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Memento pratico società commerciali 2024

Giuffrè Francis Lefebvre, 2023

ISBN 978-88-288-2441-1 | 2024-02-20 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Mendelssohns Gärten wie der "Jude von Berlin" in Lauben, Parks und Sommerfrischen fand, was zum Leben nötig ist

Lackmann, Thomas

Suhrkamp Verlag Jüdischer Verlag, 2023

ISBN 978-3-633-54323-6 | 2024-02-05 | 43 Land-, Forst- und Hauswirtschaft


Beschreibung: Während des Siebenjährigen Krieges lädt der Seidenkaufmann und Philosoph Moses Mendelssohn (1729-1786) seinen reisenden Freund Lessing ins Grüne ein: »Ich habe einen überaus schönen Garten, darin Sie logiren können. Er ist von Herrn Nicolai seinem nicht weit abgelegen; und Sie können alle Bequemlichkeiten darin haben, die Sie nur wünschen […]. Wie angenehm könnten wir die Abende zubringen, wenn Sie sich hierzu verstehen wollten! «Mendelssohn, von seinen Verehrern als »Jude von Berlin« gerühmt, führt trotz seiner schwachen Kondition ein aufreibendes Doppelleben zwischen Fabrikkontor und Studierstube. Thomas Lackmann zeigt ihn als Intellektuellen und Geschäftsmann, der sich zur Erholung und für die Diskussion seiner Projekte gern in Arbeits-Lauben und auf den Sommersitzen reicher Mentoren holt, was zum Leben nötig ist.

Zentraldepot: Externmagazin I, T236616 [verfügbar]

Buchcover

Menetekel der Ökozid und das Unbewusste : was die Klimakrise mit uns macht

Rasche, Jörg

Königshausen & Neumann, 2022

ISBN 978-3-8260-7782-1 | 2024-02-05 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CV 9000 R223 [verfügbar]

Buchcover

Merkantiler Minderwert von Liegenschaften

Kerschner, Ferdinand

Linde, 2023

ISBN 978-3-7073-4769-2 | 2024-02-14 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Merkblatt Sichtbetonfertigteile

Fraunhofer IRB Verlag, Januar 2023

ISBN 978-3-7388-0799-8 | 2024-02-05 | 41 Bauingenieurwesen

Zentraldepot: Externmagazin I, T236610 [verfügbar]

Buchcover

Meshfree and particle methods fundamentals and applications

Belytschko, Ted

Wiley, 2024

ISBN 978-0-470-84800-5 | 2024-02-05 | 37 Technik allgemein

Bibliothekszentrum West: Freihand, 800/SK 905 B454 [reserviert]

Buchcover

Metallarbeiten an Dach und Fassade Klempner-/ Spenglertechnik und Metallleichtbau

Siepenkort, Klaus

RM Rudolf Müller, 2023

ISBN 978-3-481-04375-9 | 2024-02-12 | 41 Bauingenieurwesen

Bibliothekszentrum West: Freihand, 800/ZH 7600 S572(4) [verfügbar]

Buchcover

Methoden der empirischen Sozialforschung

Atteslander, Peter

Erich Schmidt Verlag, 2023

ISBN 978-3-503-21276-7 | 2024-02-08 | 10 Wirtschafts- und Sozialwissenschaften allgemein


Beschreibung: Der ATTESLANDER ist ein seit vielen Jahrzehnten anerkannter Lehrbuchklassiker zur empirischen Sozialforschung: eine leicht verständliche Einführung in die wichtigsten Methoden – mit vielen Übungen und Grafiken, Beispielen und vielfältigen Bezügen zur öffentlichen Statistik und der aktuellen Sozialforschung in Deutschland, Österreich und der Schweiz. - Entstehung sozialer Daten: Grundprobleme und Forschungsablauf - Erhebung sozialer Daten: Beobachtung, Befragung, Experiment, Inhaltsanalyse und Verwendung bestehender Daten - Auswertung sozialer Daten: Stichproben, Skalierungsverfahren, mathematische und statistische Verfahren, Aufbereitung und Interpretation In der umfassend aktualisierten 14. Auflage mit neuem Autorenteam spannt das Buch den Bogen von klassischen Ansätzen bis hin zu fachlichen Zukunftsperspektiven in einer sich stets verändernden, immer stärker datengetriebenen Welt.

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 081-Atte|b [Transfer]

Buchcover

Methoden der empirischen Sozialforschung

Schnell, Rainer

De Gruyter, 2023

ISBN 978-3-11-075299-1 | 2024-02-08 | 10 Wirtschafts- und Sozialwissenschaften allgemein

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 081-Schn|b [Transfer]

Buchcover

Microstructures and mobility in the Byzantine world

Vienna University Press; V&R unipress, 2024

ISBN 978-3-7370-1497-7 | 2024-02-26 | 54 Geschichte


Beschreibung: Preview The volume – whose chapters originated at panels at the International Byzantine Congress in Belgrade and at the IMC in Leeds – seeks to offer an introduction into various aspects of social and geographical mobility, and the intrinsic relationship between the two, as well as into the microstructures of social action in the Byzantine world during the high and late Middle Ages. Based on a balanced approach to the role of personal agency and social structure, the authors of the individual chapters seek to clarify how and why various kinds of people mobilized to either change place and/or social position, or to form groups whose actions shaped social reality.

e-Medien: https://doi.org/10.14220/9783737014977

Buchcover

Mies van der Rohe Villa Wolf in Gubin : Geschichte und Rekonstruktion

DOM publishers, 2023

ISBN 978-3-86922-829-7 | 2024-02-12 | 42 Architektur

Zentraldepot: Externmagazin I, T236628 [verfügbar]

Buchcover

Mit dem österreichischen jüdischen Marxisten Bruno Frei unterwegs im 20. Jahrhundert

Oberkofler, Gerhard

trafo, 2024

ISBN 978-3-86464-259-3 | 2024-02-13 | 54 Geschichte

Hauptbibliothek: Freihand, 600/NY 9250 F862 O1 [verfügbar]

Buchcover

Mit Haut und Haar [ein neuer Fall für Tempe Brennan] : Roman

Reichs, Kathy

Buchgemeinschaft Donauland ua; RM-Buch-und-Medien-Vertrieb, 2004

2024-02-07 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742750 [verfügbar]

Buchcover

Modeling the trajectory of Alzheimer’s disease with patient-specific directly induced neurons reveals an epigenetic and functional convergence with psychiatric risk factors for dementia

Böhnke, Lena

2023

2024-02-28 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Morbus Alzheimer (AD) bleibt unheilbar und stellt eine wachsende Belastung und eine enorme Quelle für Leiden in unseren alternden Gesellschaften dar. Die Identifizierung früher Krankheitspfade ist für die Entwicklung zukünftiger Behandlungs- und Präventionsstrategien unerlässlich. Das Altern ist der bei weitem bedeutendste Risikofaktor für die Entwicklung und das Fortschreiten von AD, aber auch der Einfluss altersbedingter neuropsychiatrischer Störungen auf die Entwicklung einer leichten kognitiven Beeinträchtigung (MCI) und das Fortschreiten von AD ist erheblich. Dieses „neuropsychiatrische Risiko“ hat in etwa die gleiche Auswirkung und Bedeutung wie beispielsweise das ApoE4-bedingte genetische Risiko für AD. Interessanterweise deuten überzeugende Hinweise aus menschlichen Proben darauf hin, dass Patienten, die an psychiatrischen Erkrankungen, einschließlich einer bipolaren Störung (BD), leiden, eine signifikante Beschleunigung des biologischen Alterns und eine höhere Rate an Demenz entwickeln. Diese Beobachtungen führen zu der Hypothese, dass konvergierende altersbedingte Krankheitswege, die BD und MCI/AD gemeinsam haben, zur Initiierung und Progression von Demenz beitragen. Humane induzierte Neuronen (iNs) können direkt aus Hautfibroblasten generiert werden und stellen ein Modellsystem dar, um altersbedingte epigenetische, transkriptomische und funktionelle Veränderungen in altersäquivalenten patientenspezifischen Neuronen zu untersuchen.br /Hier präsentieren wir ein neues Krankheitsmodell zur Bewertung der Schnittstelle zwischen psychiatrischen und neurodegenerativen Signalwegen bei altersäquivalenten iNs von menschlichen Spendern, einschließlich kognitiv normaler Kontrollen, BD-, MCI- und AD-Patienten. Wir haben iN-Kulturen aus unserem Neurodegenerationsverlauf und unserer psychiatrischen Kohorte generiert und charakterisiert und festgestellt, dass iNs transkriptionell eine hohe Ähnlichkeit mit erwachsenen menschlichen Kortexproben aufweisen. Um den Entwicklungsverlauf der Neurodegeneration zu rekonstruieren und mit der neuropsychiatrischen Signatur zu überschneiden, führten wir parallele genomweite Transkriptom- und epigenomische DNA-Methylierungsanalysen von iNs von über 60 Spendern durch, gefolgt von molekularen und funktionellen Analysen der Neuronen. Interessanterweise zeigten sowohl BD- als auch MCI-iNs eine deutliche Beschleunigung ihres epigenetischen DNA-Methylierungsalters, was auf die Existenz einer überlappenden epigenetischen Signatur zwischen den beiden Krankheiten hinweist, die das Fortschreiten der Krankheit verstärken könnte. Eine unvoreingenommene Multi-Omics-Datenanalyse identifizierte epigenetische und transkriptomische Genmodule, die spezifisch in BD- und MCI-iNs konvergieren. Wichtig ist, dass diese konvergierenden Genmodule eine Überrepräsentation vieler synaptischer Genkategorien in BD und in MCI zeigten. Tatsächlich bestätigten funktionelle und molekulare Analysen eine erhöhte Synapsendichte und eine intermediäre frühe Genaktivierung bei BD- und MCI-iNs. Live-Cell Kalzium (Ca2+) Imaging identifizierte intrinsische Hypererregbarkeits-ähnliche Aktivitätsänderungen in MCI- und BD-iN-Kulturen, die den vollständigen AD-Phänotypen vorausgehen. Darüber hinaus deutet eine integrative Transkriptomanalyse auf eine Beteiligung der prä- und postsynaptischen Zelladhäsionsproteine der Neurexin- und Neuroligin-Familien hin, die diesen Veränderungen zugrunde liegen, was eine molekulare Erklärung des neuropsychiatrischen Risikos für Demenz liefert und neue Behandlungsstrategien bieten könnte.br /Unser Ziel war es außerdem, die direkte iN-Konversion menschlicher Fibroblasten wesentlich zu verbessern. Trotz der Identifizierung mehrerer niedermolekularer Enhancer erfordern die meisten iN-Protokolle mit hoher Ausbeute immer noch die Zugabe des rekombinanten Proteins Noggin. Um einen Ersatz zu finden, um die mit Noggin verbundenen technischen und wirtschaftlichen Herausforderungen zu umgehen, haben wir dynamische Genexpressionsverläufe der transformierenden Wachstumsfaktor-?-Signalübertragung (TGF?) während der iN-Konvertierung bewertet. Wir identifizierten ALK2 des knochenmorphogenetischen (BMP) Proteinzweigs mit der höchsten anfänglichen Transkripthäufigkeit und dem steilsten Abfall während der neuronalen Umwandlung. Als nächstes bewerteten wir die Wirksamkeit von Dorsomorphin-Homolog 1 (DMH1), einem hochselektiven ALK2-Inhibitor, und stellten fest, dass es Noggin in Kulturen von 15 erwachsenen menschlichen Spendern wirksam ersetzt. Noggin-freie Konversion ergibt durchweg iN-Kulturen, die eine hohe Anzahl an Neuronen mit soliden synaptischen Strukturen und grundlegender spontaner neuronaler Aktivität zu einem Drittel der Kosten aufweisen.

e-Medien: https://ulb-dok.uibk.ac.at/8605400

Buchcover

Modern man in the making

Neurath, Otto

Lars Müller Publishers, 2024

ISBN 978-3-03778-676-5 | 2024-02-21 | 45 Kunst

Zentraldepot: Externmagazin I, T454536 [verfügbar]

Buchcover

Moderne Zeiten Industrie im Blick von Malerei und Fotografie : Bucerius Kunst Forum, Hamburg, 26. Juni bis 26. September 2021

Hirmer, 2021

ISBN 978-3-7774-3799-6 | 2024-02-05 | 45 Kunst

Hauptbibliothek: Freihand, 600/LH 43550.2021 M689 [verfügbar]

Buchcover

Mond rätselhaft und mächtig

Tessloff, 2014

ISBN 978-3-7886-2073-8 | 2024-02-19 | 58 Fachlich nicht erfasste Objekte

Bibliothekszentrum West: Lesesaal, N30717/21 [verfügbar]

Buchcover

Motherhood contemporary transitions and generational change

Miller, Tina

Cambridge University Press, 2024

ISBN 978-1-009-41331-2 | 2024-01-30 | 11 Soziologie und Kulturwissenschaften


Beschreibung: As the competing demands of care and paid work become increasingly complex, has there ever been a more challenging time to be a woman and a mother? Comparing two studies conducted across two generations, Motherhood explores women''s experiences of becoming first-time mothers. Through richly narrated, real-time accounts of transition, Tina Miller examines what has changed since her original study was conducted twenty-one years ago. Using sociological and feminist perspectives, she analyses how motherhood has further intensified against a harsher neoliberal backdrop. The book examines the social, political and moral contours in which motherhood is situated which, in the contemporary context, include ideas of planned labours and work/life balance as part of potent, maternal prenatal imaginings. Birth continues to change everything, and the qualitative, longitudinal and comparative data show these ideas to be, mostly, illusory. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 658-Mill [verfügbar]

Buchcover

Multi-Objective Optimization for Liver Tumor Ablation Procedure

Gaspar, Jakov

2023

2024-02-15 | 58 Fachlich nicht erfasste Objekte


Beschreibung: eng: Planning needle trajectories in radio-frequency tumor ablation procedures is a vital and challenging task. Needle paths must meet certain requirements, for example, avoiding ribs and vessels while also making sure to ablate all tumor tissue and a safety margin of healthy tissue. After finding suitable trajectories, some provide better qualities than others and it usually requires experienced practitioners to determine the best ones. In this thesis, we present an approach using a multi-objective optimization algorithm to choose a set of optimal trajectories. We transform data from computed tomography scans into 3D meshes and formulate our constraints and objectives according to geometric calculations. We use the NSGA-III optimization algorithm to formulate two different optimization problems: one describing the problem of traditional RFA treatment planning and the other describing an approach utilizing a smaller amount of needles, using needle retraction. Solving these optimization problems results in a Pareto-optimal set of solutions. We compare results between the traditional approach and the approach using needle retraction, showcasing that we can propose treatment plans with a smaller amount of needles. Further, we present our results on a publicly available data set and clinical data from the University Hospital of Innsbruck and compare our results to the needle trajectories in the performed treatment, showing that our generated plans relate to actual treatments by clinicians.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-141202

Buchcover

Multiethnizität in Alltag und Konflikt Schein und Realität von Identitätskonstruktionen in der Balkanstadt Prizren

Gold, Johannes

Imprint Springer VS; Springer Fachmedien Wiesbaden, 2019

ISBN 978-3-658-24556-6 | 2024-02-20 | 58 Fachlich nicht erfasste Objekte

e-Medien: BibSearch

Buchcover

Mustersammlung Immobilienrecht

Fidi, Christoph

LexisNexis, 2024

ISBN 978-3-7007-8615-3 | 2024-02-12 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Muttersein im Schatten des Bedauerns Eine diskursanalytische Untersuchung des Phänomens „Regretting Motherhood“ durch den Fokus von Michel Foucault

Kirschner, Veronika

2023

2024-02-15 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: In der vorliegenden Masterarbeit steht das sozial relevante Thema „Regretting Motherhood“ im Fokus, das im deutschen Kontext als das Bedauern der Mutterschaft verstanden wird. Das Phänomen bezieht sich auf die Erfahrung von Müttern, die nach der Geburt ihres Kindes Gefühle des Bedauerns oder der Reue im Zusammenhang mit ihrer Mutterschaft erleben. Die entstandenen komplexen Emotionen können auf vielfältige Ursachen zurückgeführt werden, darunter fallen unter anderem unerfüllte Erwartungen an die Mutterschaft, gesellschaftlicher Druck zur Idealisierung des Mutterseins oder persönliche Umstände, die die Mutterschaft als belastend und konfliktreich erscheinen lassen. Dementsprechend wirft dieses Thema bedeutsame Fragen zur sozialen Wahrnehmung von Mutterschaft, den gesellschaftlichen Erwartungen an Frauen und ihrer individuellen Autonomie auf. Im Zentrum des Forschungsfokus steht die zentrale Frage, wie Frauen, umgeben von sozialen Erwartungen und Diskursen, ihre Identitäten gestalten und ihre Handlungen ausführen. Zur Behandlung dieser sensiblen Thematik wird auf die theoretische Grundlage des Theoretikers Michel Foucault zurückgegriffen, dessen Ansätze einen tiefgehenden Einblick in die Materie ermöglichen. Mithilfe einer integrativen Methode, die die Diskursanalyse mit der Weiterführung zur Gouvernementalität vereint, soll ein facettenreiches Verständnis des Phänomens erlangt werden. Dabei ermöglicht die Diskursanalyse nach Foucault, die versteckten Machtstrukturen und gesellschaftlichen Normen zu enthüllen, die die Wahrnehmung und den Diskurs über Mutterschaft formen. In einem weiteren Schritt wird die Untersuchung durch den Übergang zur Gouvernementalität erweitert. Hierbei werden die Ergebnisse der Diskursanalyse in den Kontext der gouvernementalen Gegebenheiten eingebettet und analysiert, die auf dem Neoliberalismus beruhen. Des Weiteren bietet die gewählte Methodik für die Analyse des Themas, die Grounded Theory, einen flexiblen und anpassungsfähigen Ansatz, um die vielschichtigen Daten zu erfassen. Die Daten, gesammelt aus Online-Blogs, Foren und Podcasts, repräsentieren Stimmen von Frauen, die ihre persönlichen Reflexionen über Regretting Motherhood teilen. Diese Vielfalt an Quellen ermöglicht es, ein tiefes Verständnis für die Komplexität und Nuancen dieses Themas zu entwickeln. Bei alledem strebt diese Masterarbeit das Ziel an, nicht nur zur Erweiterung des Wissens über Regretting Motherhood beizutragen, sondern sie öffnet auch ein Fenster zu den subtilen Verbindungen zwischen dem Diskurs rund um die traditionelle Mutterschaft und individueller Selbstverwirklichung. Durch den Einsatz von Foucaults Theorien, die kreative Methodik der Grounded Theory und die Nutzung von vielfältigen Datenquellen aus Online-Plattformen, ebnet diese Arbeit den möglichen Weg zu einem tieferen Verständnis eines bedeutsamen sozialen Phänomens.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-143570

Buchcover

Mystik

Vandenhoeck & Ruprecht, 2024

ISBN 978-3-666-50061-9 | 2024-02-28 | 06 Religion, Theologie

e-Medien: https://doi.org/10.13109/9783666500619

Buchcover

Nachhaltige Regionalentwicklung senza confini (ohne Grenzen) – eine chimäre Utopie oder gelebte Praxis? Die Region Tirol-Südtirol-Trentino im Fokus von grenzüberschreitender Regional Governance zwischen Österreich und Italien

Gatt, Franz

2023

2024-02-15 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: In dieser Masterarbeit werden Kernherausforderungen und Chancen von überregionaler Zusammenarbeit am Fallbeispiel zwischen Österreich und Italien, mit Fokus auf der Region Tirol-Südtirol-Trentino, analysiert. Dies wird im Rahmen einer Forschungsfrage begründet. Zu Beginn der Arbeit wird versucht, den Terminus einer nachhaltigen Region zu definieren und ihn im Spannungsfeld der Globalisierung abzugrenzen. Anschließend wird der Fokus auf Kooperationsprogramme der Europäischen Union zwischen Italien und Österreich gelegt. Als prominente Akteur*innen werden in dieser Arbeit die Europaregion Tirol-Südtirol-Trentino, sowie die Interreg Italia-Österreich mit ihren Bottom-up Ansätzen der Community-Led Local Development (CLLD), analysiert. Da jede Region ihren individuellen Charakter hat, den man für das Hintergrundverständnis miteinbeziehen sollte, wird die Region weiters auf ihre Gesamtheit, Genese, Struktur, Inhalt und Relevanz thematisiert. Im Kontext Transformation zu mehr Nachhaltigkeit mit Fokus auf das Sustainable Development Goal (SDG) Nr. 11: „Nachhaltige Städte und Gemeinden“ als holistischem Überbau, werden relevante, grenzüberschreitende Kooperationen durch die Fallbeispiele Brenner Basistunnel und Milchhof Sterzing beleuchtet. Im empirischen Teil der Arbeit werden durch qualitative Methoden die Kernherausforderungen durch eine induktive Vorgehensweise auf-gezeigt und entsprechende Problemlösungsansätze erarbeitet. Neben diesen steht das Erkenntnisinteresse für die Resilienz gegenüber exogenen Schocks. Die Arbeit soll als Ergebnis die Relevanz von nachhaltigen, grenzüberschreitenden Kooperationen beschreiben, sowie Maßnahmen für eine grenzüberschreitende und nachhaltige Region geben.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-142952

Buchcover

Nachhaltigkeit im Wandel

Junges Nachhaltigkeitsrecht Halle (Saale) 2023

Nomos, 2024

ISBN 978-3-7489-4211-5 | 2024-02-14 | 08 Recht

e-Medien: https://doi.org/10.5771/9783748942115

Buchcover

Narrow-Line Cooling of Erbium and Dysprosium

Sonnberger, Nefeli Ioli

2024

2024-02-15 | 58 Fachlich nicht erfasste Objekte

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-144295

Buchcover

Nationales und internationales Transportrecht Straße, Schiene, Luft und Wasser

Zehetbauer, Maria

Verlag Österreich, 2023

ISBN 978-3-7046-9301-3 | 2024-02-14 | 08 Recht

e-Medien: https://doi.org/10.33196/9783704693013

Buchcover

Natur erforschen und schützen

Hackbarth, Annette

Tessloff, 2013

ISBN 978-3-7886-2063-9 | 2024-02-23 | 27 Biologie allgemein

Bibliothekszentrum West: Lesesaal, N30717/68 [verfügbar]

Buchcover

Natur gestalten im Stil eines englischen Landschaftsgartens

Voigt, Annette

Synergia Verlag, 2023

ISBN 978-3-907246-84-9 | 2024-02-12 | 43 Land-, Forst- und Hauswirtschaft


Beschreibung: Von jeher tun Gärten uns Menschen gut und streben wir in die Natur. „Natur gestalten“ wendet sich genau an diese Menschen, die Gärten lieben und es naturnah und ursprünglich mögen und die neugierig sind, wie viel Englischer Landschaftsgarten im eigenen grünen Paradies steckt. Prägnante Projektbeispiele der aktuellen Gartenkultur veranschaulichen, wie dieser faszinierende Gartenstil des 18./19. Jahrhunderts unsere heutige Gartengestaltung prägt. Annette Voigt zeigt dabei Parallelen zwischen vergangenen und gegenwärtigen Gärten auf. Dieses Buch lädt alle Freizeitgärtner: innen ein, ihre Gärten, aus dem Blick der Landschaftsgärtnerei zu betrachten. Dabei bezieht die Autorin u. a. Balkone, Vor und - Gemeinschaftsgärten mit ein. In einer Tabelle zum Ankreuzen überträgt sie sehr präzise und gut anwendbar Gestaltungskriterien dieses Englischen Gartens auf Ihre Gärten. Eine anregende Entdeckungstour durch Gartenanlagen mit wertvollen Gestaltungsimpulsen. Dieses Gartenbuch nimmt Sie mit in drei der schönsten Landschaftsparks Deutschlands, den in Wörlitz, Bad Muskau und Branitz. Exzellente Gärten, die Geschichte, Natur und Gartenkunst vom Feinsten eindrucksvoll verbinden. Besonders zu Wörlitz und Branitz bietet die Lektüre intensive Einblicke, denn Annette Voigt arbeitet hier in der Gartendenkmalpflege der Hofgärtnereien mit. Erfrischend und authentisch schildert sie wie sich ihr eigenes Gärtnern durch diese Mitarbeit veränderte.

Bibliothekszentrum West: Freihand, 800/ZH 9630 V891 [verfügbar]

Buchcover

Naturschutzbrachen im Ackerbau Praxishandbuch für die Anlage und optimierte Bewirtschaftung kleinflächiger Lebensräume für die biologische Vielfalt

Berger, Gert

Natur & Text, 2011

ISBN 978-3-942062-03-9 | 2024-02-15 | 43 Land-, Forst- und Hauswirtschaft

Bibliothekszentrum West: Freihand, 800/WI 5810 B496 [verfügbar]

Buchcover

Neuverhandlung des Planeten Ettore Sottsass und Architektur im Wandel

Niederkofler, Sophia

2023

2024-02-15 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: In dieser Theoriearbeit, die auf das Projekt von Ettore Sottsass Il pianeta come festival (1972) basiert, stelle ich kritische Fragen, gehe radikalen Ideen nach und denke in drei verschiedenen Maßstäben darüber nach, wie wir als ArchitektInnen unsere Umwelt gestalten. Es ist zunächst wie eine Reise zum Planeten Erde, auf der erforscht wird, wie man eine Welt entwerfen kann. Dabei steht Sottsass Vision eines Planeten, auf dem die Menschen im Einklang mit der Natur leben, im Zentrum der Betrachtung. Die Gedanken hinter seinem Vorschlag zur Umgestaltung des Planeten werden Stück für Stück auseinandergenommen und im zweiten Maßstab in einen zeitlich-kulturellen Rahmen gesetzt. Sottsass Vision ist es, die Strukturen der Welt in seine Einzelteile zu sprengen und neu zusammenzubauen. Heute geht es nicht mehr ausschließlich um die Sprengung des Bestehenden, sondern darum, mit dem Bestehenden auf eine neue Art und Weise umzugehen. Dabei wird die Frage gestellt, warum es für ArchitektInnen wichtig ist, sich mit verschiedenen Weltanschauungen auseinanderzusetzen und wie Denkmuster aufgebrochen werden können. Im kleinsten Maßstab werden mit verschiedenen Ansätzen aus Sottsass Designphilosophie sogenannte Inseln entworfen, die aus Fundstücken und Artefakten unserer Zeit bestehen. Sottsass schafft es, mit seinem Design aus dem Kreis des Funktionierens auszubrechen und seinen Entwürfen damit eine neue Bedeutung zu geben. In einer detaillierten Betrachtung werden seine Ideen in die Gegenwart überführt, adaptiert und neu bewertet. Das Ziel ist es, parallel zu Sottsass Festivalplaneten, den Versuch zu wagen, das Leben auf dem Planeten des Anthropozäns neu zu entwerfen. Dabei werden, ähnlich wie bei dem Planeten als Festival neue Fragen entstehen, die die Komplexität der Verbindung zwischen dem Menschen und seiner Umgebung erforschen.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-143848

Buchcover

Nichtlineare Tragwerksoptimierung von Stahlfachwerken

Stuhler, Philipp Josef

Masterarbeit, Universität Innsbruck, 2023 - Volltext: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-142587

2024-03-01 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Ein wesentlicher Bestandteil der Ingenieursarbeit ist seit jeher die Optimierung von Tragwerken. Durch die Verwendung der Finite-Elemente-Methode in Kombination mit weiterer Software kann die Optimierung automatisiert und beschleunigt werden. Ziel dieser Arbeit ist die Erstellung und Überprüfung eines Optimierungsmodells für die Gewichtsminimierung von Stahlfachwerkträgern. Durch die Gewichtsreduktion wird Material eingespart und das verbleibende Material besser ausgelastet. Für die statischen Berechnungen wird ein parametrisches FE-Modell der Fachwerkträger erstellt. Anschließend wird das FE-Modell mit dem Optimierungsalgorithmus verknüpft.br / br /Zur Überprüfung des Modells werden verschiedene Tragwerkssysteme untersucht. Es erfolgt sowohl eine reine Formoptimierung als auch eine Kombination aus Form- und Querschnittsoptimierung. Es werden gelenkige und biegesteife Fachwerkträger betrachtet. Für die Stäbe wird der Spannungs- und Stabilitätsnachweis geführt.br /br /Die durchgeführten Berechnungen zeigen ein hohes Optimierungspotenzial für unterschiedliche Tragwerke. Durch die Wahl von geeigneten Randbedingungen kann die Systemhöhe und die allgemeine Form des finalen Systems beeinflusst werden. Das erstellte Modell biete die Möglichkeit, eine Vielzahl von Tragwerken zu untersuchen und zu optimieren.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-142587

Buchcover

Nichts nützt dem Staat so wie die Musik die musikalische Performance des Staates

V&R unipress, 2024

ISBN 978-3-7370-1673-5 | 2024-02-29 | 46 Musikwissenschaft

e-Medien: https://doi.org/10.14220/9783737016735

Buchcover

Niemandland leibhaftig, einsam, fern und wild - Naturerfahrungen zwischen Metropole und Wildnis

Trommer, Gerhard

Natur & Text, 2019

ISBN 978-3-942062-37-4 | 2024-02-06 | 25 Naturwissenschaften allgemein

Bibliothekszentrum West: Freihand, 800/WB 4049 T849 [verfügbar]

Buchcover

No Limit die Neunziger - das Jahrzehnt der Freiheit

Balzer, Jens

Rowohlt Berlin, Juli 2023

ISBN 978-3-7371-0173-8 | 2024-02-26 | 54 Geschichte

Bibliothek Haus der Musik: Freihand, O.22-39 [verfügbar]

Buchcover

Noahs Rabe Artenvielfalt in Äthiopien

Gedeon, Kai

NATUR & TEXT, 2022

ISBN 978-3-942062-55-8 | 2024-02-09 | 29 Zoologie

Bibliothekszentrum West: Freihand, 800/WI 5160 G295 [verfügbar]

Buchcover

Normothermic machine perfusion of the liver characterization of bioenergetic function and its predictive value towards the clinical outcome

Hofmann, Julia,,

2023

2024-02-23 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Die extrakorporale normotherme Maschinenperfusion (NMP) ermöglicht die Untersuchung der Organqualität und -funktionalität noch vor der Transplantation. Hierfür werden zuverlässige Biomarker, welche das Ergebnis nach der Transplantation vorhersagen können, benötigt. Die Erzeugung von Adenosintriphosphat (ATP) durch oxidative Phosphorylierung (OXPHOS) spielt eine entscheidende Rolle um den Energiebedarf der Leber zu decken, wofür intakte Mitochondrien erforderlich sind. Daher könnte eine detaillierte Analyse der bioenergetischen Kapazität während der NMP als zuverlässige Analyse mit prädiktivem Wert dienen.br /In dieser prospektiven klinischen Studie wurden 50 Lebern eingeschlossen und bis zu einer Dauer von 24 Stunden (h) mithilfe der NMP konserviert. Serielle Gewebebiopsien und Perfusatproben wurden am Ende der statisch kalten Lagerung (SCS), nach 1 h, 6 h und am Ende der NMP, sowie 1 h nach der Reperfusion im Empfänger genommen. Die Funktion und Integrität der Mitochondrien in den Gewebebiopsien wurde mithilfe der hochauflösenden Respirometrie (HRR) untersucht. Diese Parameter wurden dann mit dem klinischen Outcome (L-GrAFT Score) korreliert. Darüber hinaus wurden die Adenosinnukleotide sowie Glutamatdehydrogenase analysiert. Mithilfe der konfokalen Mikroskopie und Histologie wurde die Viabilität bzw. Integrität des Lebergewebes beurteilt. br /Während der SCS zeigte sich eine beträchtliche Variabilität zwischen den einzelnen Lebern, wobei die Succinat-Atmung der wichtigste Stoffwechselweg war. Nach Beginn der NMP blieb die mitochondriale Atmung stabil. Bei den 35 im Anschluss transplantierten Lebern zeigte sich in der Multivariatanalyse eine Korrelation des L-GrAFT Scores mit drei mitochondrialen Parametern, die während der ersten 6 h der NMP gemessen wurden: die LEAK-Atmung, die cytochrome c control efficiency und Effizienz der ATP-Produktion. br /Die mitochondrialen Marker für die Integrität der inneren und äußeren Mitochondrienmembran und die Effizienz der ATP-Produktion zeigten einen prädiktiven Wert im Bezug auf das klinische Ergebnis nach der Transplantation.

e-Medien: https://ulb-dok.uibk.ac.at/8708720

Buchcover

Note d'autore a tu per tu con i compositori d'oggi

Barbiano di Belgiojoso, Ricciarda

Postmedia books, 2013

ISBN 978-88-7490-089-3 | 2024-02-05 | 46 Musikwissenschaft

Zentraldepot: Externmagazin I, T236615 [verfügbar]

Buchcover

Odyssee

Tiroler Landesorchester & Orchester GmbH Innsbruck, 2023

2024-02-13 | 47 Theaterwissenschaft

Hauptbibliothek: Magazin HB, 653585 [verfügbar]

Buchcover

Odysseus aus Bagdad Roman

Schmitt, Éric-Emmanuel

Fischer-Taschenbuch, 2015

ISBN 978-3-596-19266-3 | 2024-02-22 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742838 [verfügbar]

Buchcover

Öffentlicher Luxus

Dietz, 2023

ISBN 978-3-320-02414-7 | 2024-02-15 | 10 Wirtschafts- und Sozialwissenschaften allgemein

Hauptbibliothek: Freihand, 600/QC 160 O28 [verfügbar]

Buchcover

Ökonomisches Handeln in der Drag- und Tunten-Szene ethnographische Erkundungen

Menze, Nele.

Waxmann, 2023

ISBN 978-3-8309-4656-4 | 2024-02-26 | 11 Soziologie und Kulturwissenschaften

Hauptbibliothek: Magazin HB, 355462 [verfügbar]

Buchcover

ÖNORM B 2110 Kommentar des privaten Baurechts (ABGB)

Karasek, Georg

MANZ'sche Verlags- und Universitätsbuchhandlung, 2023

ISBN 978-3-214-25105-5 | 2024-02-13 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Österreichisches Wohnrecht Kommentar

Verlag Österreich, 2023

ISBN 978-3-7046-9182-8 | 2024-02-12 | 08 Recht


Beschreibung: Die Neuauflage befindet sich auf dem Stand September 2023 und berücksichtigt alle neuen wohnrechtlichen Entscheidungen des Höchstgerichts und die aktuelle Literatur seit der Vorauflage 2017. [...] Berücksichtigt werden in dieser Auflage insbesondere auch die Änderungen durch die WEG-Novelle 2022, durch die bestimmte Rechte und Pflichten im österreichischen Wohnungseigentumsgesetz neu geregelt werden. [...]

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Österreichisches Wohnrecht Kommentar

Verlag Österreich, 2023

ISBN 978-3-7046-9347-1 | 2024-02-15 | 08 Recht

e-Medien: https://doi.org/10.33196/9783704693471

Buchcover

Österreichisches Zustellrecht

Frauenberger-Pfeiler, Ulrike

Verlag Österreich, 2023

ISBN 978-3-7046-9266-5 | 2024-02-14 | 08 Recht

e-Medien: https://doi.org/10.33196/9783704692665

Buchcover

Österreichs Jahrhundert des Naturschutzes Naturschutzgeschichte Österreichs unter besonderer Berücksichtigung des Naturschutzbundes : 100 Jahre Naturschutzbund Österreich

Unipress Verlag, 2018

ISBN 978-3-902666-58-1 | 2024-02-12 | 27 Biologie allgemein

Hauptbibliothek: Freihand, 600/AR 13120 G353 [verfügbar]

Buchcover

Of small and clumsy heroes

Fröwis, Philip

Philip Fröwis, 2022

ISBN 978-3-200-09126-9 | 2024-02-19 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 355458 [verfügbar]

Buchcover

On Aristotle : saving politics from philosophy

Ryan, Alan

Liveright Publishing Corporation a division of W W Norton & Company, 2014

ISBN 978-0-87140-706-1 | 2024-02-09 | 09 Politik

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 711-Ryan [verfügbar]

Buchcover

On the Road to Choice: The Depiction of Abortion and the Issue of Abortion Mobility in Abortion Road Movies

Lechner, Vanessa

2023

2024-02-15 | 58 Fachlich nicht erfasste Objekte


Beschreibung: eng: Whether it is discussed, contemplated, shown, or just dismissed, abortion has been depicted on screen for over a century, while abortion has been present in women’s lives a lot longer. When an unintended pregnancy storyline on screen is not ‘solved’ by miscarriage or wrong pregnancy, characters have to deal with the decision about whether to terminate their pregnancy or not. An obstacle that is often tied to abortion but rarely ever discussed is abortion travel – the often significant distance pregnant people have to cover to obtain an abortion. Even though mobility is a fundamental aspect of abortion, abortion mobility has been widely ignored in the depiction of abortion on screen. However, over the past few years, filmic abortion narratives seem as though they have been changing. In this thesis, the films Twice Shy (2016), Little Woods (2018), Unpregnant (2020), and Never Rarely Sometimes Always (2020) are analyzed, focusing on how abortion is depicted, how the element of the road trip expands on the conversation around abortion, and to what extent the characters' resulting physical and emotional journeys impact their attitudes to have an abortion. Furthermore, it will be evaluated whether or not the abortion road movie can be considered a new feminist spin on the traditional masculine road movie and, thus, a new emerging subgenre.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-142307

Buchcover

Online Marketing Manager*in Handbuch für die Praxis

Beilharz, Felix

ProQuest Ebook Central; O'Reilly, 2024

ISBN 978-3-96010-824-5 | 2024-02-15 | 13 Betriebswirtschaft


Beschreibung: Intro -- Titel -- Impressum -- Inhalt -- Vorwort -- Kapitel 1: Online-Marketing -- Wandel der Marketingkommunikation von Push zu Pull - und (teilweise) zurück zu Push -- Nutzerzahlen -- Mobile Web -- Bewegtbild und Vertical Video -- Big Data -- GAFAM -- Sprache, Assistenten, künstliche Intelligenzen -- Metaverse -- Es bleibt spannend -- Kapitel 2: Die Online-Marketing- Strategie -- Die wichtigsten Online-Marketing- Instrumente und -Kanäle -- Die wichtigsten Gatekeeper Google, YouTube, Meta, TikTok, LinkedIn und Amazon -- Online-Marketing im Marketing-Mix -- Strategie und Taktik -- Ziel- und Bedarfsgruppenanalysen -- SWOT-Analyse zur Bestimmung des Online-Marketing-Mix -- Die Customer Journey im Zentrum des Online-Marketings -- Touchpoints und Customer Experience -- Die Entwicklung einer Online-Marketing- Strategie entlang der Customer Journey -- Online-Marketing im Upper Funnel -- Online-Marketing im Lower Funnel -- Digitaler Markenaufbau als kritischer Erfolgsfaktor -- Der Einfluss des semantischen Webs (Web 3.0) auf das Online-Marketing -- Die Rolle der Marke im semantischen Web -- Das Web 3.0 und die digitale Marke -- Kennzahlen für erfolgreiches Branding -- Methoden zur Bestimmung der eigenen themenbezogenen Markenstärke anhand von Google -- Verbesserung der digitalen Markenpopularität und thematischen Markenstärke -- Die eigenen Assets als Kern der Online- Marketing-Strategie -- Kapitel 3: Content-Marketing -- Was ist Content-Marketing, und was ist Content? -- Content als wichtigster Touchpoint in der Customer Journey -- Vorteile und Nachteile von Content-Marketing -- Content-Arten -- Content-Marketing-Ziele -- Unterschied zwischen Content-Marketing- Kampagnen und Content-Marketing-Strategie -- Der Content-Marketing-Prozess -- Analyse -- Konzeption -- Produktion -- Distribution -- Evaluation -- Die Content-Marketing-Strategie.

e-Medien: BibSearch

Buchcover

Organic : Roman

Kava, Alex

Cora-Verl, 2007

ISBN 978-3-89941-408-0 | 2024-02-22 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742814 [verfügbar]

Buchcover

Organisational Adaptations A Pluralistic Perspective

Adegbite, Oluwaseun E

Imprint Springer; Springer International Publishing, 2018

ISBN 978-3-319-63510-1 | 2024-02-28 | 58 Fachlich nicht erfasste Objekte

e-Medien: BibSearch

Buchcover

Original sin

James, P. D.,.

Penguin Books, 1995

ISBN 978-0-14-024551-6 | 2024-02-20 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742804 [verfügbar]

Buchcover

Otto Neurath and the unity of science

Springer, 2011

ISBN 978-94-007-0142-7 | 2024-02-21 | 04 Philosophie

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 944-Otto [verfügbar]

Buchcover

Outdoor environmental education in higher education international perspectives

ProQuest eBook Central; Springer, 2021

ISBN 978-3-030-75980-3 | 2024-02-27 | 49 Sport und Spiele


Beschreibung: Intro -- Series Editors' Foreword -- Contents -- About the Editors and Contributors -- Editors -- Contributors -- Chapter 1: Preparing Outdoor Educators to Be Transformational Teachers and Leaders -- 1.1 Theoretical Foundations and Philosophies -- 1.2 Pedagogical Approaches and Issues -- 1.3 Outdoor Environmental Education as a Social, Cultural and Environmental Endeavour -- 1.4 Advocacy -- 1.5 Safety Management -- 1.6 Professional Practice -- References -- Part I: Theoretical Foundations and Philosophies -- Chapter 2: Philosophizing in Outdoor Environmental Education: How Might Experience Work? -- 2.1 Why Philosophizé -- 2.2 Asking Why-Questions: Peeling Away Layers of Reasoning -- 2.3 Questioning Program Design -- 2.4 Why Is Experience Important? -- 2.5 Experience as Interactions (Relationships) Between Self, Others and Environment -- 2.6 Ways of Experiencing: Occupations -- 2.7 Occupations and Self, Others, Environment -- 2.8 The Importance of Understanding Participants' Experiences -- References -- Chapter 3: Worldviews, Environments and Education -- 3.1 Conceptualising Worldviews -- 3.2 Why Consider Environmental Worldviews in OEÉ -- 3.3 Environmental Worldviews: Moving Beyond the Usual Suspects -- 3.4 Environmental Worldviews: What Does Post-humanism Dö -- References -- Chapter 4: Human-Nature Relationships: Navigating a Privileged White Landscape -- 4.1 Introduction -- 4.2 Problematic Foundations of Ecological Thinking -- 4.3 Ecology -- 4.4 Holism -- 4.5 Ecosystems -- 4.6 Performative Implications for the Present -- 4.7 The Rise of Fascist Ecologies -- 4.8 Inequitable Landscapes -- 4.9 Alternative Ecologies: Social Ecology -- 4.10 Post-natural Landscapes -- References -- Chapter 5: Developing a Sense of Place -- 5.1 What Is a Sense of Placé -- 5.2 When Space Becomes Place -- 5.3 Challenges with a sense of place.

e-Medien: BibSearch

Buchcover

Ovids Epos und die Tradition des Lehrgedichts Mythos und Elementenlehre in den "Metamorphosen"

Schmidt, Yasmin

Vandenhoeck & Ruprecht, 2021

ISBN 978-3-525-33608-3 | 2024-02-15 | 20 Klassische Philologie

Fachbibliothek Altertumswissenschaften: Freihand, 650/FX 191405 S354 [entlehnt]

Buchcover

Oyfn Sheydveg

Vandenhoeck & Ruprecht, 2023

ISBN 978-3-666-30236-7 | 2024-02-26 | 54 Geschichte


Beschreibung: In 1939, a new Yiddish journal was published in Paris under the name »Oyfn sheydveg« (At the Crossroads). The Authors, primarily Eastern European emigrés, embarked on a quest for an intellectually appropriate response to the political events unfolding before their eyes. Many contributors who were active two decades earlier as Diaspora Nationalists in diverse Eastern European Jewish political parties and institutions now explored new avenues. These included Zionism and Territorialism, but also a return to religious tradition and even to a pre-modern »ghetto life.« Unlike hardly any other literary document, »Oyfn sheydveg« sheds light on the profound crisis of these Jewish intellectuals and on the conclusions they drew in the face of the looming catastrophe.

e-Medien: https://doi.org/10.13109/9783666302367

Buchcover

Petrographie und Petrogenese eines Migmatites im "Winnebachgranit"

Hoinkes, Georg

1971

2024-02-27 | 31 Geowissenschaften

Hauptbibliothek: Magazin HB, 58081 [reserviert]

Buchcover

Pferde von frechen Fohlen und wilden Mustangs

Behling, Silke

Tessloff, 2013

ISBN 978-3-7886-2030-1 | 2024-02-23 | 29 Zoologie

Bibliothekszentrum West: Lesesaal, N30717/27 [verfügbar]

Buchcover

Pflanzenfamilien was jede Gärtnerin und jeder Gärtner wissen sollte

Bayton, Ross.

Haupt Verlag, 2023

ISBN 978-3-258-08355-1 | 2024-02-12 | 28 Botanik

Bibliothekszentrum West: Freihand, 800/ZC 51900 B631 [verfügbar]

Buchcover

Philosophie der Physik

Suhrkamp, 2012

ISBN 978-3-518-29633-2 | 2024-02-08 | 04 Philosophie

Bibliothekszentrum West: Freihand, 800/CC 3500 E75 [verfügbar]

Buchcover

Piff, Paff, Puff Prostitution in der Schweiz

Wüst, Aline,,

Echtzeit Verlag, 11. September 2020

ISBN 978-3-906807-17-1 | 2024-02-26 | 11 Soziologie und Kulturwissenschaften

Hauptbibliothek: Freihand, 600/LB 44150 W959 [verfügbar]

Buchcover

Planeten und Raumfahrt Expedition ins All

Baur, Manfred

Tessloff, 2013

ISBN 978-3-7886-2038-7 | 2024-02-23 | 26 Astronomie

Bibliothekszentrum West: Lesesaal, N30717/16 [verfügbar]

Buchcover

Poeme : = Poems

Marian, Rodica

Scriptor, 2020

ISBN 978-606-8539-45-4 | 2024-02-02 | 18 Romanistik

Hauptbibliothek: Magazin HB, 355451 [verfügbar]

Buchcover

Polargebiete Leben in eisigen Welten

Baur, Manfred

Tessloff, 2016

ISBN 978-3-7886-2100-1 | 2024-02-26 | 27 Biologie allgemein

Bibliothekszentrum West: Lesesaal, N30717/36 [verfügbar]

Buchcover

Politische Partizipation junger Erwachsener in Peru : Strategien zur Überwindung von Marginalisierung

Bosch, Claudia

Profil Verlag, Dissertation, Katholische Universität Eichstätt-Ingolstadt, 2021 - Volltext: BibSearch

ISBN 978-3-89019-753-1 | 2024-02-09 | 11 Soziologie und Kulturwissenschaften

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 652-Bosc [verfügbar]

Buchcover

Populismus ein Reader

Suhrkamp, 2022

ISBN 978-3-518-29940-1 | 2024-02-08 | 09 Politik

Hauptbibliothek: Freihand, 600/MF 3386 M693 [verfügbar]

Buchcover

Postmodernizing the Holocaust a comparative study of chosen novels

Tomczok, Marta

V&R unipress, 2023

ISBN 978-3-7370-1678-0 | 2024-02-26 | 54 Geschichte


Beschreibung: Abstract Marta Tomczok presents all Polish postmodern novels about the Holocaust, starting with “The First Splendor” by Leopold Buczkowski and ending with “The Suspected Dybbuk” by Andrzej Bart. She also presents their rich relationships with selected foreign-language prose, which intensified especially at the turn of the 20th and 21st centuries. The culmination of the entire trend is a discussion around two novels: “Tworki” by Marek Biéczyk and “Fly Trap Factory” by Andrzej Bart, which reveals the aestheticizing and post-memorial profile of Polish postmodernization and its advantage over the historiosophical trend. This monograph is not only the first such collection of post-Holocaust postmodern novels, but also the first comprehensive study of postmodernism in the literature about the Holocaust, which, thanks to comparative analysis, tries to analyze and explain the circumstances of the appearance and later disappearance of this trend from cultural landscape of the world and Poland.

e-Medien: https://doi.org/10.14220/9783737016780

Buchcover

Praxis-Guide für Digital Leader von erfolgreichen Profis lernen

Hanser, 2023

ISBN 978-3-446-47562-5 | 2024-02-20 | 13 Betriebswirtschaft


Beschreibung: Die digitale Transformation eines Unternehmens ist kein Projekt mit einem definierten Anfang und einem definierten Ende, sondern sie verlangt ein ständiges Dranbleiben, eine ständige Bereitschaft zur Weiterentwicklung und zur Veränderung kombiniert mit einem Wissen, welche Chancen und Risiken die unterschiedlichen digitalen Möglichkeiten bieten, und vieles andere mehr. Eine Herausforderung für jeden, der die digitale Transformation eines Unternehmens starten oder weiterentwickeln will. - Die digitale Transformation erfolgreich meistern - Direkt von erfahrenen Digital Leadern lernen - Chancen nutzen und Risiken handhaben (https://www.buchhandel.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 365-Prax|b [verfügbar]

Buchcover

Praxis-Handbuch Innendämmung Planung - Konstruktion - Details - Beispiele

RM Rudolf Müller Medien GmbH & Co KG, 2023

ISBN 978-3-481-04623-1 | 2024-02-12 | 41 Bauingenieurwesen

Bibliothekszentrum West: Freihand, 800/ZI 4060 F139(2) [verfügbar]

Buchcover

Prekäres Glück Adorno und die Quellen der Normativität : Frankfurter Adorno-Vorlesungen 2019

Gordon, Peter Eli,,

Suhrkamp, 2023

ISBN 978-3-518-58807-9 | 2024-02-08 | 04 Philosophie

Hauptbibliothek: Freihand, 600/CI 1337 G664 [verfügbar]

Buchcover

Produkthaftung bei nationalen und internationalen Verträgen

Hellbert, Karina

facultas, 2024

ISBN 978-3-7089-2218-8 | 2024-02-14 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Produktmanagement im digitalen Zeitalter Leitfaden zur effizienten Steuerung von Produkten und Dienstleistungen während des gesamten Produktlebenszyklus

Keite, Lothar

ProQuest Ebook Central; Haufe Group, 2022

ISBN 978-3-648-14795-5 | 2024-02-15 | 13 Betriebswirtschaft

e-Medien: BibSearch

Buchcover

Produktstrafrecht strafrechtliche Verantwortlichkeit für Produktmängel und Produktfehler

Stricker, Martin

MANZ'sche Verlags- und Universitätsbuchhandlung, 2024

ISBN 978-3-214-25413-1 | 2024-02-14 | 08 Recht

Fachbibliothek Recht: Bibliothek für Strafrecht, Strafprozessrecht und Kriminologie, [verfügbar]

Buchcover

Provinz postmigrantisch rurale Perspektiven auf Politik, Alltag und Literatur

Springer VS, 2022

ISBN 978-3-658-38674-0 | 2024-02-07 | 53 Volkskunde

Hauptbibliothek: Freihand, 600/LB 74005 G211 [verfügbar]

Buchcover

Prozessfinanzierung und Interessenkonflikte Regulierungsansätze in England, Australien und Deutschland

Boerner, Timon

Nomos, 2023

ISBN 978-3-7560-0803-2 | 2024-02-14 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilgerichtliches Verfahren, [entlehnt]

Buchcover

Prozessuales Denken und Künstliche Intelligenz

Regensburger Forum für Prozessrecht Regensburg 2021 3.

Mohr Siebeck, 2023

ISBN 978-3-16-162500-8 | 2024-02-08 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilgerichtliches Verfahren, [verfügbar]

Buchcover

Psychosoziale Gesundheit im Home-Office Handlungsempfehlungen für Unternehmen zur Unterstützung der psychosozialen Gesundheit ihrer Beschäftigten

Dosch, Daria E.

BoD – Books on Demand, 2023

ISBN 978-3-7578-8107-8 | 2024-02-08 | 05 Psychologie

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 953-Dosc [verfügbar]

Buchcover

Putins Krieg gegen die Frauen

Oksanen, Sofi

Kiepenheuer & Witsch, 2024

ISBN 978-3-462-00691-9 | 2024-02-23 | 09 Politik


Beschreibung: Der russische Angriffskrieg in der Ukraine ist in hohem Maße ein Geschlechterkrieg: Russland setzt sexuelle Gewalt in der Ukraine als Waffe ein, aber Frauenfeindlichkeit ist auch ein Instrument der internen Zentralisierung der Macht in Russland. Und sie ist ein Werkzeug des Imperialismus. Das Grauen, das Familien des Baltikums bereits einmal erleben mussten und das bis heute Wunden in den Familien hinterlassen hat, Deportationen, Besetzungen, Terror, Folter, Nazibeschuldigungen, Vergewaltigung, wiederholt sich, aber wie nie zuvor können Kriegsverbrechen dokumentiert werden, weil Journalistinnen, Richterinnen, Staatsanwältinnen und Anwältinnen beteiligt sind. Die Hoffnung besteht, dass die Straffreiheit Russlands ein Ende haben wird. In diesem sorgfältig recherchierten Essay zeigt sich Sofi Oksanen erneut als absolute Kennerin Russlands, seiner Geschichte und seiner strategischen Frauenfeindlichkeit. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 658-Oksa [verfügbar]

Buchcover

R.I.P. : Thriller

Yrsa Sigurðardóttir

btb, 2019

ISBN 978-3-442-75665-0 | 2024-02-22 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742846 [entlehnt]

Buchcover

Rabenväter Der Vater-Sohn-Konflikt in ausgewählten Werken Ludwig Winders

Oberhollenzer, Maximilian Andreas Michael

2024

2024-02-29 | 58 Fachlich nicht erfasste Objekte

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-144586

Buchcover

Radikale Männlichkeit der narzisstische Charakter und seine Sehnsucht nach Autorität

Vatter, Hanna

Alibri Verlag, 2023

ISBN 978-3-86569-356-3 | 2024-02-05 | 11 Soziologie und Kulturwissenschaften

Hauptbibliothek: Freihand, 600/MS 3120 V351 [verfügbar]

Buchcover

Radio frequency control of a trapped-ion quantum network node

Helgert, Johannes

2024

2024-02-29 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Diese Masterarbeit beschreibt zwei Implementierungen von Radiofrequenz Steuerung eines Quantennetzwerkknotens. Der Quantennetzwerkknotens basiert auf einer Kette einzelner atomarer Ionen, gefangen in einer linearen Paul-Falle mit integriertem optischen Resonator. Die erste beider Implementierungen von Radiofrequenz-Steuerung ist der Aufbau einer Rückkopplungsschaltung um die Schwingungsfrequenzen der Ionen in der Ebene orthogonal zur Ionenkette zu stabilisieren (radiale Moden). Stabile radiale Modenfrequenzen eröffnen die Möglichkeit, diese zur Ausführung von Quantenlogik-Gattern in langen Ionenketten zu nutzen. Zukünftig sollen derartig stabilisierte Schwingungsfrequenzen die Ausführung von Quantenlogik-Operationen in der Ionenkette ermöglichen, welche die radialen Schwingungsmoden nutzen. Nach Stabilisierung wurde über einen Zeitraum von einer Stunde an einem einzelnen Ion eine Standardabweichung von 35(3) Hz um eine mittlere radiale Modenfrequenz von 2,682342(10)MHz gemessen. Auf diesen Zeitskalen ist die Stabilität sowohl durch Schwankungen in der Luftfeuchtigkeit im Labor, sowie durch Rauschen in der Steuerungselektronik limitiert. Die Kohärenzzeit eines Qubits, welches in einer radialen Schwingungsmode gespeichert ist, wurde auf 13(1) ms bestimmt. Diese Kohärenzzeit ist nicht durch den Einfluss des umgebenden 50 Hz Stromnetztes limitiert, jedoch durch Rauschen in der Steuerungselektronik. Dieses Stabilitätslevel ist ausreichend um in zukünftigen Arbeiten Quantenlogik-Gatter zu implementieren. Die zweite beider Implementierung von Radiofrequenz-Steuerung ist die Integration einer Antenne in den Quantennetzwerkknoten, welche eine direkte Kopplung des 40Ca+ Grundzustands-Qubits bei einer Frequenz von 11,62MHz ermöglicht. Es wird erwartet, dass eine derartige direkte Kopplung die Kohärenzzeit des Grundzustands-Qubits verbessert und damit einen langlebigen Quantenspeicher für den Quantennetzwerkknoten bereitstellt. Die erreichte Rabi Frequenz von 2? · 8,637(6) kHz ist hauptsächlich durch die Entfernung zwischen der Radiofrequenz-Antenne und dem Ion begrenzt. Die Genauigkeit des Rotationswinkels einzelner ?-Pulse liegt im 10?4 Bereich und als dominierende Fehlerquelle wurden Leistungsabweichungen im Antennen-Schaltkreis identifiziert. Unter Nutzung der Antenne zur dynamischen Entkopplung des Grundzustand-Qubits wurde ein Ramsey Kontrast von 0,81+9?15 nach 4,16 s ermittelt. Dies repräsentiert eine signifikante Verbesserung verglichen mit dem zuvor besten Ergebnis in unserem System, in welchem ein Ramsey Kontrast von 0,67(3) nach 66 ms ohne die Radiofrequenz-Antenne gemessen wurde. Abschließend ist das dynamisch entkoppelte Grundzustands-Qubit ein Quantenspeicher welcher beliebige Qubit-Zustände speichern kann. Ein Qubit wurde über 4.16 s mit einer durchschnittlichen Zustands-Ähnlichkeit von F = 0.80+6?10 gespeichert, was beweist dass Speicherzeiten von mehreren Sekunden nun in unserem Quantennetzwerkknoten verfügbar sind.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-144491

Buchcover

Raman sideband spectroscopy and optical pumping for imaging purposes of 39K in an optical lattice

Reiter, Florian

2023

2024-02-22 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Verschiedene Methoden der Laserkühlung sind für die Experimentalphysik im Bereich der ultrakalten Atome und Teilchenfallen von großer Bedeutung. Ein fundamentaler Teil solcher Experimente ist die Bildgebung. Die vorliegende Arbeit schlägt ein Schema der Raman-Seitenband-Kühlung vor, welches für die Bildgebung von 39K Atomen geeignet ist. Als Teilchenfalle fungiert ein optisches Gitter mit einer Tiefe von ungefähr kB · 4 ?K. Mithilfe eines um 38 GHz rotverstimmten Raman-Transfers konnte erfolgreich ein Seitenband-Spektrum aufgenommen werden, wobei der Lamb-Dicke-Parameter rund 0.48 beträgt. Dieses Seitenband-Spektrum weist ein rotes, und mehrere blaue Seitenbänder auf, was darauf hindeutet, dass gebundene und freie Bloch-Zustände im optischen Gitter individuell adressiert werden können. Zusätzlich wurde ein Schema für optisches Pumpen, welches die Atome zurück in elektronischen Ausgangszustand bringt und damit den Kühlungszyklus schließt, realisiert und characterisiert. Erwärmung und Atomverluste stellen dabei noch ein Problem dar, jedoch konnten die Atome innerhalb von 400 ?s mit einer Rotverstimmung von 20 MHz in den elektronischen Ausgangszustand überführt werden. Die Berechnung der gesamten Streurate für das optische Pumpen ergibt 62 kHz. Des Weiteren wird ein Leistungsstabilisationsschema präsentiert, welches auf dem Prinzip der optisch-heterodynen Detektion basiert. Die Schema wurde für zwei Methoden bezüglich der Verarbeitung der Führungsgröße getestet und konnte die Leistung eines Lasers innerhalb einer Bandbreite von 14 kHz stabilisieren.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-143622

Buchcover

Reading autobiography a guide for interpreting life narratives

Smith, Sidonie

ProQuest Ebook Central; University of Minnesota Press, 2010

ISBN 978-0-8166-7345-2 | 2024-02-29 | 15 Allgemeine Sprach- und Literaturwissenschaft

e-Medien: BibSearch

Buchcover

Reati contro la pubblica amministrazione

G Giappichelli Editore, 2022

ISBN 978-88-921-4342-5 | 2024-02-08 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Strafrecht, [verfügbar]

Buchcover

Recherchieren, Dokumentieren, Zitieren : die Arbeit mit wissenschaftlichen Quellen

Niedermair, Klaus

UVK Verlag, 2023

ISBN 978-3-8252-6066-8 | 2024-01-05 | 01 Allgemeines und Interdisziplinäres


Beschreibung: Der Erfolg einer Prüfungs- und Abschlussarbeit hängt vor allem davon ab, wie gut und sicher wissenschaftliche Quellen recherchiert, ausgewertet und zitiert werden. Doch wie lässt sich die Relevanz und Qualität einer wissenschaftlichen Quelle erkennen? Wie wird sie dokumentiert und in der eigenen Arbeit verwendet? Diese und weitere Fragen klärt Klaus Niedermair in seinem Buch. Er zeigt, wie ein zielgerichtetes Projektmanagement im wissenschaftlichen Arbeiten aussieht. Dabei gibt er mit Leitfäden, Checklisten, Übungen und praktischen Beispielen Hilfe zur Selbsthilfe. Neu in der zweiten Auflage hinzugekommen sind Abschnitte zum Schreiben wissenschaftlicher Texte, zum korrekten Zitieren und zur Vermeidung von Plagiaten. Auch auf Künstliche Intelligenz und ihre Auswirkungen für die Informationsrecherche und das Verfassen von Texten geht der Autor ein. (https://www.buchhandel.de) https://www.blickinsbuch.de/item/f28804070d6afefcccebc9261411e5ac

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 090-Nied|b [verfügbar]

Buchcover

Recht auf Reparatur Vertragliche Umsetzung und Herausforderungen für das Handwerk

Arnold, Stefan

Nomos, 2024

ISBN 978-3-7560-1265-7 | 2024-02-08 | 08 Recht

Fachbibliothek Recht: Bibliothek für Internationales Privatrecht, [verfügbar]

Buchcover

Recht und Religion

Vandenhoeck & Ruprecht, 2024

ISBN 978-3-666-50039-8 | 2024-03-01 | 06 Religion, Theologie

e-Medien: https://doi.org/10.13109/9783666500398

Buchcover

Rechtsdogmatik Stand und Perspektiven

Dike Verlag AG; Verlag CH Beck; MANZ'sche Verlags- und Universitätsbuchhandlung, 2023

ISBN 978-3-214-02642-4 | 2024-02-22 | 08 Recht

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Rechtsphilosophie Einführung

Kirste, Stephan

Academia; Nomos, 2024

ISBN 978-3-7560-1406-4 | 2024-02-22 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Finanzrecht, [verfügbar]

Buchcover

Rechtswissenschaft als Argumentationswissenschaft transnationales Toleranzprinzip oder hegemonialer Letztbegründungsanspruch?

Lagodny, Otto

Facultas; Nomos, 2023

ISBN 978-3-8487-8702-9 | 2024-02-27 | 08 Recht

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Regenerative Energiesysteme Technologie – Berechnung – Klimaschutz

Quaschning, Volker

Hanser Carl, 2024

ISBN 978-3-446-47777-3 | 2024-02-12 | 37 Technik allgemein

Bibliothekszentrum West: Freihand, 800/ZP 3700 Q1(12) [verfügbar]

Buchcover

Religion auf Instagram Analysen und Perspektiven

Herder, 2023

ISBN 978-3-451-39626-7 | 2024-02-07 | 06 Religion, Theologie

Fachbibliothek Theologie: Freihand, PA 06-250 PIRK [verfügbar]

Buchcover

Revolution : eine Geistesgeschichte

Traverso, Enzo

Verlag Turia + Kant, 2023

ISBN 978-3-98514-077-0 | 2024-01-29 | 09 Politik

Hauptbibliothek: Freihand, 600/MD 8300 T781 [verfügbar]

Buchcover

Revolutionary biographies in the 19th and 20th centuries imperial – inter/national – decolonial

V&R unipress, 2024

ISBN 978-3-7370-1248-5 | 2024-02-26 | 54 Geschichte


Beschreibung: A new view on already-known and recently-discovered revolutionary biographies

e-Medien: https://doi.org/10.14220/9783737012485

Buchcover

Rhetorik der Säkularisierung : über eine Denkfigur der Moderne

Weidner, Daniel

Campus Verlag, 2024

ISBN 978-3-593-51831-2 | 2024-02-08 | 04 Philosophie


Beschreibung: »Säkularisierung« ist ein so wichtiger wie umstrittener Begriff zur Selbstverständigung westlicher Gesellschaften – er meint sowohl das Verschwinden der Religion in der Moderne als auch deren Verwandlung. Daniel Weidner zeigt, wie im 20. Jahrhundert von Säkularisierung gesprochen wurde und wie zentral diese Überlegungen für das philosophische, theologische, soziologische und kulturelle Selbstverständnis waren. Dabei erweist sich Säkularisierung weniger als klares Konzept denn als Denkfigur, die gerade durch ihre Rhetorik – durch Metaphern und Mehrdeutigkeiten – in der Lage ist, das ambivalente Verhältnis der Moderne zur Religion zum Ausdruck zu bringen. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 662-Weid [verfügbar]

Buchcover

Ricerche sulle tecniche di scrittura delle Istituzioni di Gaio

Arces, Pierfrancesco

Giappichelli, 2022

ISBN 978-88-921-4397-5 | 2024-02-13 | 08 Recht

Fachbibliothek Recht: Bibliothek für Römisches Recht, [verfügbar]

Buchcover

Ripensare i musei dopo la pandemia atti della giornata di studio : Museo della Centuriazione Romana di Borgoricco (7 maggio 2022)

Ripensare i musei dopo la pandemia Borgoricco 2022 Veranstaltung

Editreg, 2023

ISBN 978-88-3349-068-7 | 2024-02-14 | 58 Fachlich nicht erfasste Objekte


Beschreibung: La cultura e il mondo dei musei stanno accusando il colpo del cambiamento accelerato generato dalla pandemia. Una crisi, ma anche un’opportunità per le istituzioni culturali, che dovranno ridisegnarsi un ruolo innovativo di servizio al Paese

Fachbibliothek Altertumswissenschaften: Freihand, 650/NH 7711 A656 A6-95 [verfügbar]

Buchcover

Robert Scherer Leben für die Kunst ; Werksverzeichnis

Studia Verlag, 2023

ISBN 978-3-99105-051-3 | 2024-02-08 | 45 Kunst

Hauptbibliothek: Magazin HB, 675741 [verfügbar]

Buchcover

Russland von innen : Leben in Zeiten des Krieges

Krisai, Paul

Paul Zsolnay Verlag, 2023

ISBN 978-3-552-07369-2 | 2024-02-23 | 09 Politik

Hauptbibliothek: Magazin HB, 742819 [reserviert]

Buchcover

Sätze über Sätze ABC des wachen Denkens

Gabriel, Markus

Kein & Aber, 2023

ISBN 978-3-0369-5021-1 | 2024-01-30 | 04 Philosophie

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 941-Gabr [verfügbar]

Buchcover

Same-sex couples before national, supranational and international jurisdictions

Springer, 2014

ISBN 978-3-642-35433-5 | 2024-02-14 | 08 Recht

Fachbibliothek Recht: Bibliothek für Europarecht, [verfügbar]

Buchcover

Schiffe vom Einbaum zum Ozeanriesen

Finan, Karin.

Tessloff, 2013

ISBN 978-3-7886-2048-6 | 2024-02-23 | 44 Verkehr und Mobilität

Bibliothekszentrum West: Lesesaal, N30717/25 [verfügbar]

Buchcover

Schock-Zeiten wie Deutschland den wirtschaftlichen Abstieg verhindert

Hagelüken, Alexander

CHBeck, 2023

ISBN 978-3-406-80773-2 | 2024-02-08 | 10 Wirtschafts- und Sozialwissenschaften allgemein


Beschreibung: Die Deutschen leben in Schockzeiten. Die Preise sind hoch wie nie. Viele Industriebetriebe drohen abzuwandern. Bei der Infrastruktur hinken wir international weit hinterher. Überall fehlen Arbeitskräfte. Und das Land wird von aggressiven Mächten wie China und Russland bedrängt. Der Wirtschaftsexperte Alexander Hagelüken analysiert, wie die Bundesrepublik in den letzten Jahrzehnten ins Abseits geriet. Um seinen Wohlstand zu retten, muss Deutschland wirtschaftspolitische Tabus brechen: bei den Finanzen und beim Klimaschutz, bei Industrieförderung und Digitalisierung, bei Welthandel, Zuwanderung, Rente und Gleichberechtigung. Hagelükens Buch ist ein dringend nötiger Weckruf, der zeigt, wie wir den wirtschaftlichen Abstieg noch verhindern können. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 245-Hage [verfügbar]

Buchcover

Schreiben lernen und lehren im Studium der Sozialen Arbeit

wbv, 2023

ISBN 978-3-7639-7053-7 | 2024-02-20 | 15 Allgemeine Sprach- und Literaturwissenschaft


Beschreibung: In dieser Publikation beschreiben, reflektieren und erforschen Lehrende und Studierende der Sozialen Arbeit, wie Schreiben in ihren hochschulischen Kontexten gelernt und gelehrt wird. Im Zentrum stehen erprobte Lehr-Lern-Konzepte im Studium der Sozialen Arbeit, die auf das Schreiben in Arbeitskontexten vorbereiten, zur professionellen Identitätsentwicklung beitragen oder aber auch auf die Persönlichkeitsentwicklung abzielen. Die in den Beiträgen thematisierten Schreibformen sind beruflicher, fachlich-professioneller, wissenschaftlicher, wissenschaftlich-reflexiver und journalistischer Art. Die Publikation gliedert sich in vier Abschnitte: Im ersten Abschnitt beleuchten die Beiträge die studentische Schreibpraxis zwischen Hochschulsozialisation und Profession. Im zweiten Teil nehmen die Beiträge Schreiben als Instrument der professionellen Entwicklung in den Blick. Der dritte Teil befasst sich mit der Frage, wie textuelle Wirklichkeitskonstruktionen verstanden werden können. Im vierten Abschnitt wird Schreiben als Werkzeug zur Generierung von wissenschaftlichem Wissen im Studium der Sozialen Arbeit betrachtet. Ergänzt werden die Lehrkonzepte im letzten Beitrag des Bandes durch eine qualitative Studie, die Schreiblehr- und -lernprozesse nicht bei den Studierenden, sondern bei den Lehrenden fokussiert. Mit schreibdidaktischen Impulsen für die Integration des Schreibens in die Lehre richtet sich der Sammelband vor allem an Fachlehrende der Sozialen Arbeit. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 591-Schr [verfügbar]

Buchcover

Schrunser Gasthäuser mit Geschichte

Gabriel, Lisa-Marie

Heimatschutzverein Montafon, 2023

ISBN 978-3-902225-94-8 | 2024-01-25 | 54 Geschichte

Hauptbibliothek: Magazin HB, 388608 [verfügbar]

Buchcover

Schulbauten - Debatten, Darstellungen und Aneignungspraktiken von 1968 bis heute

Zepp, Eva

transcript, 2023

ISBN 978-3-8376-6663-2 | 2024-02-05 | 42 Architektur

Zentraldepot: Externmagazin I, T236609 [verfügbar]

Buchcover

Schulkultur an japanischen Mittelschulen

Di Bernardo, Luciana

Masterarbeit, Universität Innsbruck, 2022 - Volltext: BibSearch

2024-02-22 | 07 Pädagogik


Beschreibung: ger: In meiner Masterarbeit untersuche ich japanische Schulkultur an Mittelschulen. Dabei werfe ich einen Blick auf die Definition des Begriffs „Schulkultur“ und verwende unter anderem Ansätze und Modelle von Schein und Helsper als Basis für meine Theorie. Da das japanische Schulsystem eventuell fremd sein könnte, werden ebenso die Grundschule und die Mittelschule beschrieben. Zudem werden meine persönlichen Erfahrungen als Mittelschullehrerin, sowie meine Erfahrungen als Deutsch Assistenz an der Rikkyo Universität in diese Masterarbeit miteinfließen. br /Die japanische Schulkultur unterscheidet sich in vielen Aspekten von der Österreichischen. Die Gestaltung des Unterrichts, die Teilnahme an den Unterricht seitens der Schüler:innen, sowie die einzelnen Lernziele, werden an japanischen Schulen anders gestaltet. Ebenso sind das Tragen von Schuluniformen und die Teilnahme an Clubaktivitäten Elemente, die sich von österreichischen Schulen hervorheben. Hinter diesen sichtbaren Aspekten verbergen sich jedoch auch soziale Spannungsverhältnisse und Herausforderungen, die auf den ersten Blick nicht sichtbar sind. Von dem extremen Leistungsdruck über Mobbing und Ausgrenzung von Schüler:innen, bis hin zu Selbstmorden aufgrund mangelnder akademischer Leistungen; die japanische Schulkultur gleicht einem Eisberg mit vielen Faktoren, die ohne intensiver Beschäftigung mit dieser Thematik, auf den ersten Blick nicht sichtbar sind. br /Diese intensive Beschäftigung mit anderen Schulkulturen kann jedoch für Lehrpersonen, unabhängig der Nationalität, von Vorteil sein. Es ist mitunter die Aufgabe von Lehrpersonen und Schulleitungen im Sinne ihrer Professionalität, über den Rand hinauszublicken, sich weiterzubilden und andere Schulkulturen zu beobachten; gerade deshalb, weil Diversität an vielen Schulen ein wichtiges Thema ist und Lehrpersonen dazu verpflichtet sind, dem Individualismus der Kinder zu begegnen.

Hauptbibliothek: Magazin HB, DG67780 [verfügbar]

Buchcover

Schwarze Seelen Roman

Kava, Alex.

Cora Verl, 2003

ISBN 978-3-89941-067-9 | 2024-02-14 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742764 [verfügbar]

Buchcover

Schwestern die Macht des weiblichen Kollektivs

Korbik, Julia

Rowohlt, 2024

ISBN 978-3-498-00372-2 | 2024-02-15 | 11 Soziologie und Kulturwissenschaften


Beschreibung: Ob #metoo oder die Proteste im Iran: In den letzten Jahren gab es zahlreiche Anlässe, bei denen Frauen füreinander eintraten. Ein Prinzip, das schon die Feminist:innen der 1970er-Jahre propagierten – nicht umsonst lautete einer ihrer bekanntesten Slogans: Sisterhood is powerful! Aber Schwesterlichkeit ist mehr als Networking, mehr als weibliche Solidarität. Es ist eine politische Praxis. Julia Korbik setzt sich mit dem Prinzip der Schwesterlichkeit auseinander, will verstehen, wie sie aussehen kann – und was sie verhindert. Sie hinterfragt den Feminismus der letzten Jahre und erforscht dieses Thema anhand persönlicher Anekdoten, Beispiele aus Literatur, Popkultur, Geschichte und Gesellschaft inspirierend, nuanciert und neugierig. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 843-Korb [verfügbar]

Buchcover

Scrum Think big Scrum für wirklich große Projekte, viele Teams und viele Kulturen

Gloger, Boris

Carl Hanser Verlag, 2024

ISBN 978-3-446-47718-6 | 2024-02-20 | 58 Fachlich nicht erfasste Objekte

e-Medien: https://doi.org/10.3139/9783446477186

Buchcover

Searching Christology through an Asian optic

ISPCK Jesuits in Religious Studies (JERES), 2017

ISBN 978-81-8465-610-7 | 2024-02-15 | 06 Religion, Theologie

Fachbibliothek Theologie: Magazin, N-20192 [verfügbar]

Buchcover

Security Network: The Collective as an Effective Means of Protecting the Individual

Haid, Franziska

2024

2024-02-22 | 58 Fachlich nicht erfasste Objekte


Beschreibung: eng: This master's thesis explores the evolving landscape of cybersecurity, focusing on protecting indi-vidual users from the sophisticated threat of Spear Phishing attacks. In response to the increasing prevalence of cyberattacks and the personalized nature of Spear Phishing, this research employs a field experiment methodology that goes beyond conventional approaches. The study not only em-phasizes technical measures but also delves into the analysis of human behavior and social inter-actions within networks.br /The research problem stems from the advanced evolution of attack methods, leading to more real-istic and challenging Social Engineering attacks. The thesis addresses the need for adjustments and progress in awareness training and sensitization, branching out in various directions. Specifi-cally, it aims to understand the role of the collective in individuals' susceptibility to Spear Phishing attacks by examining the influence of network structure and group dynamics measured through Social Network Analysis (SNA) parameters.br /This interdisciplinary approach integrates psychology, computer science, and social sciences, plac-ing complex interactions between individual behavior, social networks, and network security at the forefront. The research results are expected to contribute not only to the development of effec-tive strategies against Spear Phishing attacks but also to enhance individual and collective cyber-security. Insights gained from the study are intended to inform the design of training and awareness programs for better user protection against sophisticated threats.br /In contrast to previous research that primarily focused on individual training programs, this work highlights the importance of group dynamics, revealing that the social environment significantly impacts susceptibility to Spear Phishing attacks. The comprehensive field study conducted over approximately six months involved data collection, honeypot profile creation, spear phishing at-tacks, and statistical and social network analysis.br /The thesis commences with an exposition of theoretical background, covering key themes such as Social Engineering, Spear Phishing Susceptibility, Social Network Analysis, and the Phishing Funnel Model. The exploration of these topics provides a profound understanding of the intricate interconnections essential for interpreting the subsequent sections.br /The main section critically analyzes existing literature, elucidates methodological approaches, and presents empirical findings. By testing hypotheses, the study aims to identify group aspects con-tributing to reducing susceptibility to Spear Phishing attacks, bridging current research gaps and providing relevant implications for both theory and practice. The objective is to make a substantial contribution to science and offer potential recommendations for businesses and other institutions in the ever-evolving landscape of cybersecurity.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-145660

Buchcover

Seemanns Lexikon der Ikonografie religiöse und profane Bildmotive

Riese, Brigitte

Seemann, 2007

ISBN 978-3-86502-102-1 | 2024-02-12 | 45 Kunst

Hauptbibliothek: Magazin HB, 388623 [verfügbar]

Buchcover

Selbst philosophieren ein Methodenbuch

Damschen, Gregor

De Gruyter, 2024

ISBN 978-3-11-058917-7 | 2024-02-12 | 04 Philosophie


Beschreibung: Die dritte, vollständig überarbeitete Auflage des bewährten Studienbuches wurde um elf Einträge erweitert: Abduktion (Schluss auf die beste Erklärung), Clusterdefinition, Experimentelle Philosophie, Explikation, Kontextdefinition, Kriterien, Methode, Naturalistischer Fehlschluss, Neologismus, notwendig und hinreichend – mengentheoretisch und Stipulative Definition. Zudem enthält der Band einen wertvollen Anhang mit einem philosophischen Kanon, den wichtigsten logischen Regeln und einem umfangreichen Register, das neben den deutschen auch alle wichtigen englischen Fachbegriffe umfasst. Wer philosophieren will, muss, methodisch betrachtet, vor allem drei Dinge tun: analysieren, argumentieren und interpretieren. Jede Person – ob Anfänger/in, Schüler/in, Student/in oder fortgeschrittene/r Wissenschaftler/in – kann mit diesem Buch lernen, Begriffe zu analysieren, Argumente zu verstehen, zu bewerten und zu entwickeln. Im Unterschied zu anderen Einführungsbüchern kommt auch die Interpretation zu ihrem vollen Recht. Mit diesem Buch können die Methoden der Philosophie praxisnah gelernt und geübt werden. Es präsentiert deshalb so etwas wie einen methodischen Werkzeugkasten, der sich ausgezeichnet für die Schule, die Universität und auch das Selbststudium eignet. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 941-Dams [verfügbar]

Buchcover

Selbstständige Unselbstständigkeit Crowdworking zwischen Autonomie und Kontrolle

Nomos; edition sigma, 2019

ISBN 978-3-8452-9335-6 | 2024-02-23 | 13 Betriebswirtschaft

e-Medien: https://doi.org/10.5771/9783845293356

Buchcover

She city designing out women’s inequity in cities

Kalms, Nicole

Bloomsbury Visual Arts, 2023

ISBN 978-1-350-15307-3 | 2024-02-14 | 42 Architektur

Bibliothekszentrum West: Freihand, 800/ZH 9301 K14 [verfügbar]

Buchcover

Shelf

Bruther Firma

Spector Books OHG, 2023

ISBN 978-3-95905-730-1 | 2024-02-12 | 42 Architektur

Bibliothekszentrum West: Freihand, 800/ZH 3750 B913 [verfügbar]

Buchcover

Simone de Beauvoir : eine illustrierte Biografie

Neubauer, Lisa

Unrast, Oktober 2023

ISBN 978-3-89771-370-3 | 2024-01-30 | 04 Philosophie

Hauptbibliothek: Freihand, 600/IH 15601 N477 [verfügbar]

Buchcover

Social media consumption, information avoidance, and political ideology – An experimental design in the context of climate change

Dahlke, Bob

2023

2024-02-22 | 58 Fachlich nicht erfasste Objekte


Beschreibung: eng: In today’s era of a digitally interconnected world, social media has gained an enormous influence on the proliferation of news due to its global connectivity. This master thesis delves into the interaction between behavioural economics and the implications on economic theory while combining insights of phenomena like information avoidance and political polarization on social media platforms. We analyze the evolution of information sources on the internet, which often lead to selective exposure among users, creating echo chambers and filter bubbles. Furthermore, we connect behavioural economics with general economic principles by employing the framework of public-, club-, common- and private goods and searching for both positive- and negative externalities associated with social media use. This analysis reveals some interesting insights in the potential for fostering climate activism but also for propagating misinformation. A central concern is also that of intensifying polarization in the online debate and its repercussions on climate change beliefs. The experimental design is structured in a way that it centers on climate-related decision-making scenarios, while it is intended to explore the implications on information avoidance in examining decision-making contexts, that are intended to reveal the complex interplay of social media use as a news source, climate change decisions, and information avoidance.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-143274

Buchcover

Social mobility

Heath, Anthony F.

polity, 2024

ISBN 978-0-7456-8306-5 | 2024-02-06 | 11 Soziologie und Kulturwissenschaften


Beschreibung: Social mobility has long been one of the central topics of sociology. It has been the subject of major theoretical contributions from the earliest generations of scholars, as well as being of persistent political interest and concern. Social mobility is frequently used as a key measure of fairness and social justice, given the central role that modern liberal democracies give to equality of opportunity. More pragmatically, policymakers often consider it a force for economic growth and social integration. However, discussions of social mobility have increasingly become dominated by advanced statistical techniques, impenetrable to all but specialists in quantitative methods. In this concise and lucid book, Anthony Heath and Yaojun Li cut through the technical literature to provide an eye-opening account of the ideas, debates and realities that surround this important social phenomenon. Their book illuminates the major patterns and trends in rates of social mobility, and their drivers, in contemporary western and emerging societies, ultimately enabling readers to understand and engage with this perennially relevant social issue. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 670-Heat [verfügbar]

Buchcover

Soft law and its importance in ensuring member states' compliance with union law

Weismann, Paul

Nomos, 2024

ISBN 978-3-7489-3586-5 | 2024-02-14 | 08 Recht

e-Medien: https://doi.org/10.5771/9783748935865

Buchcover

Solennità di Maria, Madre di Dio storia e teologia

Di Napoli, Giovanni

Centro Liturgico Vincenziano, 2023

ISBN 978-88-7367-320-0 | 2024-02-07 | 06 Religion, Theologie

Fachbibliothek Theologie: Freihand, 210-R1 DINA [verfügbar]

Buchcover

"Soluto matrimonio dotem reddi" profili ricostruttivi dello scioglimento del matrimonio e della disciplina giuridica della dote

Giumetti, Fausto

Giappichelli, 2022

ISBN 978-88-921-2448-6 | 2024-02-13 | 08 Recht

Fachbibliothek Recht: Bibliothek für Römisches Recht, [verfügbar]

Buchcover

Souverän & selbstbewusst der gelassene Umgang mit Selbstzweifeln

Wardetzki, Bärbel

Kösel, 2014

ISBN 978-3-466-31028-9 | 2024-02-09 | 05 Psychologie

Hauptbibliothek: Magazin HB, 742781 [verfügbar]

Buchcover

Soziale Innovation durch religiöse Tradition Peers und Engagement von jungen Christ/innen und Muslim/innen mit Migrationsgeschichte

Modler-El Abdaoui, Magdalena

LIT, 2023

ISBN 978-3-643-51105-8 | 2024-02-13 | 06 Religion, Theologie

Fachbibliothek Theologie: Freihand, ITR 17-030 MODL [entlehnt]

Buchcover

Sozialer Wandel

Schrader, Heiko,,

transcript Verlag, 2024

ISBN 978-3-8252-6238-9 | 2024-02-02 | 58 Fachlich nicht erfasste Objekte


Beschreibung: Sozialer Wandel ist ein zentrales Thema soziologischen Denkens. Heiko Schrader gibt einen Überblick über die Anfänge der klassischen soziologischen Theoriebildung, widmet sich aber auch verschiedenen Kritiken der etablierten westlichen Modernisierungstheorie. Dabei setzt er unter dem Aspekt der Pfadabhängigkeit von Entwicklung den Fokus auf die Spezifik der Modernisierung in postkolonialen und postsozialistischen Gesellschaften. Empirisch angereichert und didaktisch aufbereitet erweitert er das Forschungsfeld für Studierende der Soziologie und Politikwissenschaft um die Sichtweisen der außereuropäischen Welt und des globalen Südens. Die leicht zugängliche Einführung fängt so die Vielfalt der (postkolonialen) Moderne ein – und hinterfragt das Konzept des sozialen Wandels kritisch. (https://www.transcript-verlag.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 674-Schr|b [verfügbar]

Buchcover

Sozialer Zusammenhalt vor Ort Analysen regionaler Mechanismen

Campus Verlag, 2024

ISBN 978-3-593-51817-6 | 2024-02-15 | 11 Soziologie und Kulturwissenschaften


Beschreibung: Gesellschaftlicher Zusammenhalt besteht nicht von selbst, sondern ist auf bestimmte Mechanismen seiner Genese angewiesen. Davon ausgehend beschäftigen sich die Beiträge dieses Bandes mit der Frage, welche Mechanismen dies konkret sind und wie sie sich hervorbringen lassen. Auf der Grundlage einer eigenen repräsentativen Panelstudie diskutieren sie, wie soziale Kohäsion auf lokaler Ebene etabliert und aufrechterhalten werden kann. Zugleich verdeutlichen ihre Analysen die Vielfalt der empirischen Erklärungsansätze gesellschaftlichen Zusammenhalts. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 668-Sozi|b [verfügbar]

Buchcover

Speaking in bones

Reichs, Kathy,,

arrow books, 2015

ISBN 978-0-09-955812-5 | 2024-02-07 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742763 [verfügbar]

Buchcover

Spinnen Jäger am seidenen Faden

Rigos, Alexandra

Tessloff, 2013

ISBN 978-3-7886-2060-8 | 2024-02-23 | 29 Zoologie

Bibliothekszentrum West: Lesesaal, N30717/73 [verfügbar]

Buchcover

SS-Geiseln am Pragser Wildsee der Leidensweg prominenter KZ-Häftlinge aus 17 Ländern Europas nach Südtirol

Richardi, Hans-Günter

Zeitgeschichtsarchiv Pragser Wildsee, März 2006

ISBN 978-88-902316-0-5 | 2024-01-30 | 54 Geschichte

Hauptbibliothek: Magazin HB, 653532 [verfügbar]

Buchcover

Staat, Fortschritt, Anarchie politische Schriften

Reclus, Élisée

Matthes & Seitz, 2024

ISBN 978-3-7518-3000-3 | 2024-02-26 | 09 Politik

Hauptbibliothek: Freihand, 600/MC 7700 R299 [verfügbar]

Buchcover

Stakeholder und Netzwerke in Naturparks am Beispiel des Naturpark Weißbach bei Lofer

Hell, Christoph

2023

2024-02-15 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Schutzgebiete spielen eine besondere Rolle beim Schutz der Natur, der regionalen Entwicklung und dem Erhalt des kulturellen Erbes. Sie sind aber aufgrund diverser Stakeholderinteressen und einem komplexen Netzwerk schwer zu managen. Ein entscheidender Erfolgsfaktor für das Management von Schutzgebieten ist es die Interessen, Werte und Einstellungen der Stakeholder zu verstehen und untereinander bestehende Verbindungen zu kennen. Diese Arbeit widmet sich den Themen Zusammenarbeit, Kommunikation, Macht, Konflikte und Trends in Bezug auf Stakeholder in Schutzgebieten. Dabei erfolgt eine Kategorisierung der Stakeholder und die Darstellung des Netzwerks. Die methodische Grundlage bildet eine qualtitative Forschung im Naturpark Weißbach (Salzburger Land, Österreich) bei welcher Agierende (n=14) aus den Bereichen Landwirtschaft, Forstwirtschaft, Jägerschaft, Tourismus, Outdoorsport, Alpenverein, Gemeinde und dem Naturpark selbst durch semi-struckturierte Interviews befragt wurden. Die Ergebnisse der qualitativen Inhaltsanalyse betonen die zentrale Bedeutung von Partizipation und Zusammenarbeit für den Erfolg von Schutzgebieten. Das Stakeholder-Netzwerk in Schutzgebieten zeigt sich als komplexes und dynamisches Konstrukt mit vielfältigen Verbindungen. Konflikte zwischen Menschen und Tieren als auch zwischen Interessensgruppen treten auf, wobei vor allem der Outdoorsport als kritisch betrachtet wird. Zukünftige Entwicklungen wie die Biodiversitätskrise, der Arbeitskräftemangel und die Digitalisierung prägen bereits jetzt und werden auch künftig das Management des Schutzgebiets und die Stakeholder in der Region fordern.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-143771

Buchcover

State secrecy and democracy : a philosophical inquiry

Mokrosinska, Dorota

Routledge, 2024

ISBN 978-1-003-08373-3 | 2024-03-01 | 04 Philosophie


Beschreibung: Introduction -- Government transparency : grounds and limits -- Reclaiming raison d'etat : the necessity of executive secrecy -- Do states have a right to privacy? -- Democratic authority of government secrecy -- Legislative secrecy in deliberation and voting / co-authored with Suzanne Bloks.

e-Medien: https://doi.org/10.4324/9781003083733

Buchcover

Steiermärkisches Landesrecht

Verlag Österreich, 2023

ISBN 978-3-7046-9222-1 | 2024-02-15 | 08 Recht

e-Medien: https://doi.org/10.33196/9783704692221

Buchcover

Steiermärkisches Landesrecht

Verlag Österreich, 2023

ISBN 978-3-7046-9221-4 | 2024-02-15 | 08 Recht

e-Medien: https://doi.org/10.33196/9783704692214

Buchcover

Steiermärkisches Landesrecht

Verlag Österreich, 2023

ISBN 978-3-7046-9220-7 | 2024-02-15 | 08 Recht

e-Medien: https://doi.org/10.33196/9783704692207

Buchcover

Steinschlag - rechtlicher Rahmen und Haftung Pflichten, Haftung, Vorsorge

Verlag Österreich, 2023

ISBN 978-3-7046-9268-9 | 2024-02-14 | 08 Recht

e-Medien: https://doi.org/10.33196/9783704692689

Buchcover

Sterne Wunder des Weltalls

Tessloff, 2014

ISBN 978-3-7886-2042-4 | 2024-02-22 | 26 Astronomie

Bibliothekszentrum West: Lesesaal, N30717/6 [verfügbar]

Buchcover

Steuer-Erlässe Durchführungsrichtlinien und Erlässe des BMF zu den Abgabengesetzen

Österreich

Linde, 2024

ISBN 978-3-7073-4945-0 | 2024-02-12 | 08 Recht


Beschreibung: KODEX Steuer-Erlässe 2018, Band IV 31. Auflage, Stand 1.2.2018 Mit der APP zum Gesetz Insbesondere mit: – Umsatzsteuerrichtlinien – Umsatzsteuer-Erlässe – Neugründungs-Förderungs-RL – Gebührenrichtlinien – Grunderwerbsteuererlässe – BAO-Erlässe – Kontenregister- und Konteneinschauerlass Aktuell: – UStR-Wartungserlass 2017 – Neue GrEStG-Info 2017 – MVSKR-Wartungserlass 2017 – EnAbgR-Wartungserlass 2017

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 021-StE39,4 [verfügbar]

Buchcover

Steuern kompakt 2024 eine Einführung in die Steuerlehre

Tumpel, Michael

Linde Verlag GesmbH, 2024

ISBN 978-3-7073-4911-5 | 2024-02-29 | 10 Wirtschafts- und Sozialwissenschaften allgemein

e-Medien: https://www.lindedigital.at/plink/st-kompakt2024

Buchcover

Steuerrevolution ein Konzept zur Rückverteilung von Reichtum, zu mehr Gerechtigkeit und Klimaschutz

Hentschel, Karl-Martin

VSA Verlag, 2024

ISBN 978-3-96488-201-1 | 2024-02-26 | 10 Wirtschafts- und Sozialwissenschaften allgemein

Hauptbibliothek: Freihand, 600/QL 400 G727 [verfügbar]

Buchcover

Stoppt Ableismus! Diskriminierung erkennen und abbauen

Gersdorff, Anne

ROWOHLT Taschenbuch Verlag, 2024

ISBN 978-3-499-01187-0 | 2024-02-19 | 11 Soziologie und Kulturwissenschaften


Beschreibung: Die Diskriminierung von Menschen mit Behinderungen ist der Grund, warum auch heute noch nicht alle Menschen gleichberechtigt am Leben teilhaben können. Noch immer verhindern Berührungsängste einen Dialog über Ableismus. So bleiben nahezu 15 Prozent der globalen Bevölkerung von der Gesellschaft ausgeschlossen. Ohne erhobenen Zeigefinger, mit einfachen Erklärungen und anhand anschaulicher Beispiele legt dieses praxisorientierte Handbuch Barrieren und Ausschlussmechanismen der Dominanzgesellschaft offen. Es bietet damit den idealen Ausgangspunkt, um die eigenen Privilegien als nicht behinderte Person zu erkennen, zu hinterfragen und Diskriminierung und Barrieren ein für alle Mal abzubauen. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 660-Gers [reserviert]

Buchcover

StoreLess: Data-aware scheduler in Federated FaaS

Hautz, Mika

2023

2024-02-15 | 58 Fachlich nicht erfasste Objekte


Beschreibung: eng: Function-as-a-Service (FaaS) has become integral to scientific computing, offering serverless technology for running functions across diverse cloud environments. The core concept of FaaS revolves around improving the accessibility and granularity of computing functions, liberating developers from operational concerns and infrastructure considerations. These functions are connected in serverless workflows or Function Choreographies (FCs), to create a complete application. Leveraging multiple cloud providers in FaaS federation enables the exploitation of each provider’s strengths, tailoring solutions to specific use-cases. With more complex serverless workflows, particularly in applications processing substantial data, the complexity of orchestrating workflows for optimal execution increases. The need to store and access intermediate data efficiently becomes paramount. With a majority of serverless applications relying on cloud storage, strategic function and storage pairing becomes crucial. Data locality emerges as a critical factor, influencing the speed at which data is accessed, especially when functions and data are distributed across regions globally. While federated FaaS offers flexibility in optimizing functions for cost and performance benefits, manually exploring the multitude of possibilities is time- and cost-intensive. This master thesis addresses the challenge of data-aware scheduling in federated FaaS by developing a scheduler that aims to minimize workflow makespan while considering data locality. Moreover, several serverless AFCL workflows are characterized, a novel deployment framework is presented, and a data-aware simulator for federated FaaS is introduced. Evaluation of the workflows reveals notable performance differences between cloud providers. Specifically, AWS demonstrates faster data download and computation compared to GCP, while GCP exhibits faster upload speeds to collocated storage. Using our deployment framework facilitates deployment of serverless functions in federated FaaS, by reducing lines-of-code by up to 9.23× compared to state-of-the-art IaC frameworks Terraform and Serverless Framework. The AccessLess simulator with its data transfer model accurately simulates the overall makespan of data-intensive FCs with 93.3% accuracy, while reducing the effort to set up simulation parameters by 72.56% compared to other execution and simulation models. By using the StoreLess scheduler, workflow execution time is improved by up to 21.48% for big data astrophotography workflows.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-144002

Buchcover

Stowasser lateinisch-deutsches Schulwörterbuch

Verlag Hölder-Pichler-Tempsky (hpt); Oldenbourg Schulbuchverlag, 2016

ISBN 978-3-637-01549-4 | 2024-02-19 | 20 Klassische Philologie

Hauptbibliothek: Freihand, 600/FN 2475 S891.2016 [verfügbar]

Buchcover

Strategic Measures and Competitiveness: An Analysis of Deutsche Börse in Comparison to Other Exchanges

Manasseh, Edith Njeri

2023

2024-02-19 | 58 Fachlich nicht erfasste Objekte


Beschreibung: eng: This thesis attempts to answer the following research question: “Which strategic measures has Deutsche Börse pursued to strengthen its competitive position compared to those strategies employed by the London Stock Exchange Group and the Intercontinental Exchangé”br /The significance of this research question lies in investigating the strategic measures of Deutsche Börse in its competitive sector. Additionally, light is shed on how the company implements competitive strategies, which strategies the company follows and whether these strategies are successful. This is all carried out within the framework of a comparing the executed strategies of the London Stock Exchange Group and the Intercontinental Exchange with those of Deutsch Börse.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-143190

Buchcover

Strategien für Reuse in der Architektur

Curtze, Tassilo

2024

2024-02-15 | 58 Fachlich nicht erfasste Objekte

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-145004

Buchcover

Strategisches Produktmanagement Produktstrategien und -Roadmaps für digitale Produkte und agile Teams

Pichler, Roman

dpunkt Verlag, 2023

ISBN 978-3-86490-965-8 | 2024-02-16 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 479-Pich [verfügbar]

Buchcover

Structural Enhancement and Connection of Borates and Tellurates

Ziegler, Raimund

2024

2024-02-29 | 58 Fachlich nicht erfasste Objekte

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-144650

Buchcover

Strukturbegriffe der Religionspädagogik Festgabe für Werner Simon zum 65. Geburtstag und anlässlich seiner Pensionierung

Klinkhardt, 2015

ISBN 978-3-7815-2027-1 | 2024-02-07 | 06 Religion, Theologie

Fachbibliothek Theologie: Freihand, RP 01-100 PORZ [verfügbar]

Buchcover

Strukturwandel des öffentlichen Rechts Entstehung und Demokratisierung der europäischen Gesellschaft

Bogdandy, Armin von

Suhrkamp, 2022

ISBN 978-3-518-29956-2 | 2024-02-19 | 08 Recht

Fachbibliothek Recht: Bibliothek für Europarecht, [verfügbar]

Buchcover

Studierende Emerging Adults während der COVID-19-Pandemie : eine qualitative Längsschnittstudie zu partnerschaftlichen Interaktionen und Beziehungszufriedenheit

Roesch, Friederike Lina

Masterarbeit, Universität Innsbruck, 2023 - Volltext: BibSearch

2024-02-21 | 05 Psychologie

Hauptbibliothek: Magazin HB, DG67773 [verfügbar]

Buchcover

Sturzflug Thriller

Kava, Alex

Diana, 01/2018

ISBN 978-3-453-35956-7 | 2024-02-20 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742796 [verfügbar]

Buchcover

Successioni e donazioni

Capozzi, Guido

Giuffrè Francis Lefebvre, 2023

2024-02-16 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Successioni e donazioni

Capozzi, Guido

Giuffrè Francis Lefebvre, 2023

2024-02-16 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Successioni e donazioni

UTET Giuridica, 2023

2024-02-16 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Successioni e donazioni

UTET Giuridica, 2023

2024-02-16 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Südtirols Geschichte der Landwirtschaft und die Resilienz landwirtschaftlicher Betriebe im oberen Vinschgau

Hutter, Kathrin

2023

2024-02-15 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Im Jahr 2022 haben 160 Milchviehbetriebe Südtirols ihre Tore geschlossen. Steigende Kosten und eine hohe Arbeitsbelastung erschweren das Fortbestehen der Betriebe. Ein Blick in die unmittelbare Vergangenheit lässt erkennen, dass das Leben der bäuerlichen Bevölkerung jedoch schon seit jeher von Veränderungen und oftmals beträchtlichen Herausforderungen geprägt wird. Ziel dieser Arbeit ist es, zu beantworten, wie und warum Milchviehbetriebe ihre Resilienz seit der zweiten Hälfte des 20. Jahrhunderts erhalten und ausbauen können. Dazu wird folgende Forschungsfrage gestellt: br /Wie wird die sozial-ökologische Resilienz landwirtschaftlicher Betriebe im oberen Vinschgau seit der zweiten Hälfte des 20. Jahrhunderts hergestellt, gesichert und erweitert? br /Um die Forschungsfrage zu beantworten, wurde nach einem Blick auf die historische Entwicklung der Landwirtschaft im Alpenraum und in Südtirol eine qualitative Studie innerhalb des Forschungsgebietes der Gemeinde Mals durchgeführt. Konkret wurden durch Interviews die Strategien zur Stärkung der Resilienz ermittelt und analysiert. Die Auswertung zeigt, dass die in die Untersuchung einbezogenen landwirtschaftlichen Betriebe während der demographischen, klimatischen, wirtschaftlichen, administrativen und legislativen Veränderungen wie Herausforderungen ihre Handlungsfähigkeit und folglich Resilienz bewahren. Aus der Datenanalyse geht zudem hervor, dass sich die Strategien zur Stärkung der Resilienz im Untersuchungszeitraum von rund siebzig Jahren nicht in ihrer Form wandelten, sondern sich lediglich den gegebenen Bedingungen sowie Werten der Hofmitglieder anpassten. Um die Resilienz der Betriebe auch zukünftig gewährleisten zu können, gilt es Anreize für den Erhalt und die Stärkung der Mehrgenerationenbetriebe, den Ausbau der inner- und außerbetrieblichen Vernetzung, die Stärkung des sozial-ökologischen Gedächtnisses, den Ausbau lokaler Kreisläufe, eine selbstständige Initiierung von Veränderungen und all den mit den Strategien einhergehenden Werten zu schaffen.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-144251

Buchcover

Supermacht Wissenschaft unsere Zukunft zwischen Himmel und Hölle

Jaeger, Lars

Gütersloher Verlagshaus, 2017

ISBN 978-3-579-08682-8 | 2024-02-14 | 25 Naturwissenschaften allgemein

Fachbibliothek Theologie: Freihand, ITR 25-010 JAEG [verfügbar]

Buchcover

Svaneti Museum

Georgian National Museum, 2020

ISBN 978-9941-8-2120-2 | 2024-02-13 | 45 Kunst

Hauptbibliothek: Magazin HB, 388622 [verfügbar]

Buchcover

SWK-Spezial: Umsatz­steuer 2024

Melhardt, Stefan

Linde Verlag GesmbH, 2024

ISBN 978-3-7073-4918-4 | 2024-02-29 | 08 Recht

e-Medien: https://www.lindedigital.at/plink/swks-ust2024

Buchcover

Symbiotic paradise zwischen Weltgarten und Windarchitektur

Marte, Melissa

2023

2024-02-15 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Ein historischer Wendepunkt wurde jüngst erreicht: Alles Menschengemachte überwiegt erstmals die weltweite Biomasse. Unsere moderne Lebensweise entfremdet uns von der Natur und damit unserer Lebensgrundlage. Dieses Projekt geht der Frage nach, wie erneut eine liebevolle Koexistenz mit der Natur durch einen respektvollen Umgang mit ihren Ressourcen entstehen kann. Wie gelingt es uns, die Natur und damit uns selbst wieder zu lieben?br /In der libanesischen Küstenstadt Beirut soll auf dem ehemaligen Hafengelände ein Stadtgarten entstehen, welcher durch seine Gestaltung dem Menschen eine andere Sicht auf die Natur ermöglicht. Während ein botanischer Garten die Darstellung einer Natur ist, die vom Menschen konstruiert wird, konstruiert hier die Natur einen Raum, dessen Ausgestaltung ihre Gesetze bestimmen. Anstelle des Menschen soll der Wind den Garten gestalten. Die Abgabe der menschlichen Kontrolle im Entwurfsprozess steht dem anthropozentrischen Weltbild entgegen und ermöglicht uns die nötige Distanz, um einen neuen Blickwinkel hinsichtlich unseres Verhältnisses zur Natur einzunehmen.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-143839

Buchcover

Tabellenbuch Holztechnik Tabellen - Formeln - Regeln - Bestimmungen

Peschel, Peter

Verlag Europa-Lehrmittel Nourney Vollmer GmbH & Co KG, 2023

ISBN 978-3-7585-4689-1 | 2024-02-05 | 37 Technik allgemein

Bibliothekszentrum West: Freihand, 800/ZI 4300 P473(13) [verfügbar]

Buchcover

Tango mortale Roman

Kohout, Pavel

Osburg-Verl, 2015

ISBN 978-3-95510-073-5 | 2024-02-26 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742829 [verfügbar]

Buchcover

Tarifautonomie und Tarifgeltung zur Legitimation und Legitimität der Tarifautonomie im Wandel der Zeit

Höpfner, Clemens

Duncker & Humblot, 2021

ISBN 978-3-428-18422-4 | 2024-02-27 | 08 Recht

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Teaching and learning with primary source projects real analysis, topology and complex variables

MAA Press, 2023

ISBN 978-1-4704-6989-4 | 2024-02-13 | 23 Mathematik, Statistik

Bibliothekszentrum West: Institut für Grundlagen/Mathematik, [verfügbar]

Buchcover

Teenager-Hirn was in der Pubertät im Kopf Ihres Kindes los ist

Jensen, Frances E.

Goldmann, Juni 2016

ISBN 978-3-442-17604-5 | 2024-02-12 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CQ 6600 J54 [entlehnt]

Buchcover

The big picture how to use data visualization to make better decisions - faster

Wexler, Steve

ProQuest Ebook Central; McGraw Hill, 2021

ISBN 978-1-260-47353-7 | 2024-02-26 | 58 Fachlich nicht erfasste Objekte


Beschreibung: Not a data expert? Here's an engaging and entertaining guide to interpreting and drawing insights from any chart, graph, or other data visualization you'll encounter. You're a business professional, not a data scientist. How do you make heads or tails of the data visualizations that come across your desk-let alone make critical business decisions based on the information they're designed to convey? In The Big Picture, top data visualization consultant Steve Wexler provides the tools for developing the graphical literacy you need to understand the data visualizations that are flooding your inbox-and put that data to use. Packed with the best four-color examples created in Excel, Tableau, Power BI, and Qlik, among others, this one-stop resource empowers you to extract the most important information from data visualizations quickly and accurately, act on key insights, solve problems, and make the right decisions for your organization every time

e-Medien: BibSearch

Buchcover

The book proposal book a guide for scholarly authors

Portwood-Stacer, Laura

Princeton University Press, 2021

ISBN 978-0-691-21572-3 | 2024-02-16 | 01 Allgemeines und Interdisziplinäres

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 090-Port [entlehnt]

Buchcover

The Cambridge companion to Gandhi

Cambridge University Press, 2011

ISBN 978-0-511-92116-2 | 2024-02-19 | 58 Fachlich nicht erfasste Objekte


Beschreibung: Even today, six decades after his assassination in January 1948, Mahatma Gandhi is still revered as the father of the Indian nation. His intellectual and moral legacy, and the example of his life and politics, serve as an inspiration to human rights and peace movements, political activists and students. This book, comprised of essays by renowned experts in the fields of Indian history and philosophy, traces Gandhi's extraordinary story. The first part of the book explores his transformation from a small-town lawyer during his early life in South Africa into a skilled political activist and leader of civil resistance in India. The second part is devoted to Gandhi's key writings and his thinking on a broad range of topics, including religion, conflict, politics and social relations. The final part reflects on Gandhi's image and on his legacy in India, the West, and beyond.

e-Medien: https://doi.org/10.1017/CCOL9780521116701

Buchcover

The Cambridge companion to Winston Churchill

Cambridge University Press, 2023

ISBN 978-1-108-87925-5 | 2024-02-19 | 54 Geschichte

e-Medien: https://doi.org/10.1017/9781108879255

Buchcover

The colours of spatial planning perspectives from the TU Wien's research units

Verlag Österreich, 2023

ISBN 978-3-7083-4151-4 | 2024-02-15 | 58 Fachlich nicht erfasste Objekte


Beschreibung: Every year, an increasing number of students complete their spatial planning studies at the TU Wien to gain a foothold in professional life. Since the course of study was established, this has already added up to around 1,000 graduates. After graduation, some of them moved to other Länder or beyond the national border, yet many have not been able to 'let go' of Vienna. At any rate, one thing is clear: spatial planners operate in places where people live. A look at the spatial distribution of the population thus allows us to make a guess as to where former students of the TU Wien are 'planning space'. Even though they may operate in separate sectors, each of them has become part of a dynamic spatial planning landscape that has its roots in spatial planning studies at the TU Wien. This landscape is what the cover of this book illustrates. The dots represent TU Wien graduates. Besides, the authors who contributed to making this commemorative publication a reality are displayed in red. This English-language online edition contains the yearbook contributions by the eleven research units that have decisively shaped the course of study. The approximately 690-page German-language edition of the Spatial Planning yearbook of the Institute of Spatial Planning at TU Wien (2020), Fifty Years of Spatial Planning at TU Wien — Studying – Teaching – Research, can be requested from the publisher at the Institute of Spatial Planning.

e-Medien: https://doi.org/10.37942/9783708341514

Buchcover

The continuum concept in search of happiness lost

Liedloff, Jean

Penguin Books, 2004

ISBN 978-0-14-019245-2 | 2024-02-08 | 27 Biologie allgemein

Bibliothekszentrum West: Freihand, 800/WU 3000 L718 [verfügbar]

Buchcover

The democracy disadvantage how populism impedes democracies and galvanizes authoritarianism in the face of disaster

Grodsky, Brian K.,,

ProQuest Ebook Central; Rowman & Littlefield, 2024

ISBN 978-1-5381-9212-2 | 2024-02-27 | 09 Politik

e-Medien: BibSearch

Buchcover

The dormition and assumption of the Virgin Mary

Brepols, 2023

ISBN 978-2-503-60617-0 | 2024-02-27 | 06 Religion, Theologie


Beschreibung: This volume includes eight new translations of early Christian narratives about the end of the Virgin Mary's life, that is, her Dormition and Assumption. Translated from Greek, Latin, Syriac, Ethiopic, Georgian, and Christain Palestinian Aramaic, each of these texts is either translated into a modern language for the first time, or appears in a version that has not previously been published. The texts represent a broad range of the highly diverse early Christian memories of Mary's departure from this world. Likewise, the texts themselves often disclose a range of theological diversity within the early Christian tradition even beyond what scholars have thus far recognized.

e-Medien: https://www.brepolsonline.net/doi/book/10.1484/M.APOCR-EB.5.133716

Buchcover

The dynamics of managing diversity and inclusion a critical approach

Kirton, Gill

Routledge Taylor & Francis Group, 2022

ISBN 978-1-03-202937-5 | 2024-02-12 | 13 Betriebswirtschaft


Beschreibung: The Dynamics of Managing Diversity and Inclusion was one of the first books to respond to growing academic coverage of the topic of diversity management at degree level. This fifth edition has been fully updated to reflect new working practices, labour market data, organisational policies, and developments in equality and diversity law, as well as including new case studies and analysis of current and emerging areas of debate in the United Kingdom and across Europe.Diversity management is a term that covers not only policy and practice on race, disability, and sex discrimination, but also broader issues including other identity and cultural differences. The Dynamics of Managing Diversity and Inclusion, fifth edition, provides future HR professionals and business/organisational managers of the future with the legal information and research findings needed to enable them to participate in the development and implementation of meaningful diversity and inclusion policies in their organisations. This new edition offers:Inclusion of topical issues such as female and minority representation on executive boards, religious diversity, gender identity, Black Lives Matter and #MeToo movements.Multiple analytical perspectives, such as socio-legal and feminist approaches, to provide rich insights into the subject matter.Practical case studies and exercises to illustrate the real-life issues in a local, international, and organisational context.The book deals with the subject of diversity management in a rigorous and structured manner, beginning each chapter with aims and objectives, providing key learning points and review and discussion questions at regular junctures, and ending with concluding thoughts and observations, making this book the perfect support resource for those teaching or studying in the field of equality, diversity, and inclusion

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 368-Kirt [entlehnt]

Buchcover

The formation of biblical texts chronicling the legacy of Gary N. Knoppers

Mohr Siebeck, 2024

ISBN 978-3-16-162756-9 | 2024-02-22 | 06 Religion, Theologie


Beschreibung: In welchem Verhältnis standen der Pentateuch und das (sogenannte) Deuteronomistische Geschichtswerk und wie funktionierten diese Texte als Korpus? Welche Verbindungen gab es zwischen diesen Texten und denen der Chronik, von Esra und Nehemiä In diesem Band kommen führende Stimmen zusammen, um zu Ehren von Gary N. Knoppers Fragen über die Komposition und Entstehung der Hebräischen Bibel und die künftige Richtung solcher Studien zu erörtern.

e-Medien: https://doi.org/10.1628/978-3-16-162756-9

Buchcover

The forms of water in clouds and rivers, ice, and glaciers

Tyndall, John

Cambridge Univ Press, 2011

ISBN 978-1-108-03783-9 | 2024-02-22 | 31 Geowissenschaften

e-Medien: https://doi.org/10.1017/CBO9781139097093

Buchcover

The fundamentals of ethics

Shafer-Landau, Russ

Oxford University Press, 2021

ISBN 978-0-19-005831-9 | 2024-02-15 | 04 Philosophie


Beschreibung: Auf dem Uschlag: An exceptionally clear, compact, and affordable introduction to a broad range of ethical theories

Fakultaetsbibliothek SoWi: MCI-I, Universitätsstr. 15, 945-Shaf [verfügbar]

Buchcover

The governance of style : public buildings in Central Europe, 1780-1920

Vandenhoeck & Ruprecht; Böhlau, 2023

ISBN 978-3-205-21754-1 | 2024-03-01 | 42 Architektur


Beschreibung: Abstract: The architecture of some public buildings exhibits a commitment to economic restraint and a subordination to an international aesthetic of dutifulness. Other public buildings exhibit a heightened sensitivity to place – to topography, architectural setting, and select cultural inheritances. The decision-making processes that led up to the implementation of such projects are often insufficiently appreciated. The 20 contributions to this volume, focused on Central Europe, address the problem of defining and locating public buildings as architectural expressions in a protracted period of transition between feudal and modern constitutional social orders.

e-Medien: https://doi.org/10.7767/9783205217541

Buchcover

The influence of family blockholders on the financial behavior of listed family firms

Franzoi, Fabio

Peter Lang, 2023

ISBN 978-3-631-90127-4 | 2024-02-20 | 13 Betriebswirtschaft


Beschreibung: This dissertation investigates the influence of large family shareholders on financial decisions and the performance of listed firms in Germany. This country is especially interesting, as the German corporate governance system is considered less investor- friendly with a limited influence of shareholders on managerial decisions. Based on the incentive structure of family blockholders and their influence in corporate boards, the four studies offer a novel approach to analyzing the financial behavior of family firms. They use a hand-collected panel dataset identifying blockholders and every board position in 278 corporations. The dissertation demonstrates that the degree of family involvement in boards significantly influences working capital and earnings management as well as stock market performance and provides contributions for academia and practitioners alike. (https://www.buchhandel.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 407-Fran [verfügbar]

Buchcover

The materials of service design

Blomkvist, Johan.

Edward Elgar Publishing, 2023

ISBN 978-1-80220-329-5 | 2024-02-12 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: MCI-III, Weiherburgg. 8, 562-Blom [verfügbar]

Buchcover

The nature of supply networks

Choi, Thomas Y.

Oxford University Press, 2023

ISBN 978-0-19-767327-0 | 2024-02-23 | 58 Fachlich nicht erfasste Objekte

e-Medien: https://doi.org/10.1093/oso/9780197673249.001.0001

Buchcover

The operas of Johann Christian Bach an introduction

The Packard Humanties Institute, 2023

ISBN 978-1-938325-51-9 | 2024-02-29 | 58 Fachlich nicht erfasste Objekte


Beschreibung: The scope of this volume is limited to the eleven full-length operas by Bach. The essays were written with a dual purpose: first, to provide stand-alone studies of Bach's operas to promote admiration and understanding of those works; and secondly, to serve as introductions to the critical editions in Johann Christian Bach: The Operas. The collection begins with an introduction by John A. Rice, which provides a historical overview of Bach's career as an opera composer. The individual essays are then organized chronologically by opera, beginning with Margaret R. Butler's study of Bach's first Italian opera, Artaserse, written for Turin (1761). Next is Lucio Tufano's essay on the two operas for Naples, Catone in Utica (1761) and Alessandro nell'Indie (1762). Bach then wrote four operas over three seasons for London, as discussed in essays by Michael Burden on Orione, ossia Diana vendicata and Zanaida (both 1763), John A. Rice on Adriano in Siria (1765), and Stephen Roe on Carattaco (1767). Paul Corneilson's essay on Temistocle (1772) and Lucio Silla (1775) covers Bach's two operas for Mannheim. Bach provided one more opera for London, La clemenza di Scipione (1778), the subject of Karl Böhmer's study. The collection concludes with an essay by Beverly Wilcox on Bach's sole French opera, Amadis de Gaule (1779), written for Paris--

Bibliothek Haus der Musik: Freihand, [Transfer]

Buchcover

The Oxford companion to black British history

Oxford University Press, 2007

ISBN 978-0-19-172733-7 | 2024-02-15 | 54 Geschichte

e-Medien: https://doi.org/10.1093/acref/9780192804396.001.0001

Buchcover

The Oxford handbook of early childhood learning and development in music

Oxford University Press, 2023

ISBN 978-0-19-092752-3 | 2024-02-15 | 46 Musikwissenschaft


Beschreibung: The Oxford Handbook of Early Childhood Learning and Development in Music brings together leading researchers in infant and early childhood cognition, music education, music therapy, neuroscience, cultural and developmental psychology, and music sociology to interrogate questions of how our capacity for music develops from birth, and its contributions to learning and development

Bibliothek Haus der Musik: Freihand, PA.10-36/21 [verfügbar]

Buchcover

The Palgrave international handbook of women and outdoor learning

ProQuest eBook Central; Palgrave Macmillan US, 2018

ISBN 978-3-319-53550-0 | 2024-02-27 | 49 Sport und Spiele


Beschreibung: Intro -- Foreword:Nourishing Terrains-Nurturing Terrains:Networks of Connections -- References -- Acknowledgements -- Contents -- Editors and Contributors -- List of Figures -- List of Tables -- Part I -- 1: Nourishing Terrains: Women's Contributions to Outdoor Learning Environments -- Introduction: Be Bold for Change -- Another Parallel Story -- Double Jeopardy -- An Epiphany: Nourishing Conversations -- Our Next Challenge: Convincing Women Writers for the Handbook -- Our Optimistic Mission -- Within (and Beyond) the White Male Academy -- Standing as a United Voice as Vanguards of Change -- Concluding Comments -- References -- 2: Let's Meet at the Picnic Table at Midnight -- Stereotypes of Outdoor Women -- Women in Outdoor Learning Environments: There Is Not a Single Story -- Not All Women's Trips Are the Same -- A Take on Women's History in Outdoor Learning -- Early Women Adventurers -- Early Programming Differences for Girls and Boys, Women and Men -- Counter the Silence with More Picnic Tables and More Voices -- References -- 3: Thirty Years on, and Has the Gendered Landscape Changed in Outdoor Learning? -- Hooked… -- Unconscious Bias Within Our Gendered Outdoor Learning Terrain -- Feminism in Outdoor Terrains: A Brief Potted History -- Initiating a Long Overdue Conversation with the Outdoor Profession -- When Did Feminist Become Such a Dirty Word? -- Time to Apply the Bechdel Test in OEE -- A Call to Action: Time to Push the Reset Button -- Men and Women Must Orchestrate Change Together -- Conclusion -- References -- 4: Outdoor Education: Threaded Pathways to Belonging -- Introduction -- The 1960s -- The 1970s -- The 1980s -- The 1990s -- The 2000s -- The 2010s… -- References -- 5: Elder Women Speak of Outdoor Learning and Experience -- Setting the Scene: Gathering for Conversation -- Introduction -- Beginnings-Finding Ground.

e-Medien: BibSearch

Buchcover

The Role of Emotions in Investment Decisions: The Effects of Vividness of a Crowdfunding Campaign Video

Sander, Julian Christoffer

2024

2024-02-22 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Aktuelle Forschung im Bereich Crowdfunding vernachlässigt häufig die Rolle von Emotionen bei Investitionsentscheidungen und die Auswirkungen der unterschiedlichen Bildhaftigkeit von Kampagnenvideos. Unter Verwendung des Emotion-Imbued Choice Model (Lerner et al., 2015) wird in dieser Studie untersucht, wie verschiedene Stufen der Bildhaftigkeit eines Kampagnenvideos die Emotionen und die anschließende Investitionsentscheidung beeinflussen. Unter Verwendung eines quantitativen Ansatzes mit einem Zwischensubjektdesign wurden die Teilnehmer entweder einem Kampagnenvideo oder einer Infografik mit identischem Ton ausgesetzt. Die emotionalen Reaktionen wurden mit TAWNY, einem Deep-Learning-Tool zur Erkennung von Emotionen im Gesicht, analysiert. Zusätzlich wurden mit Fragebögen Investitionsentscheidungen, selbstberichtete Emotionen und Bewertungen des Stimulus erfasst. Die Ergebnisse deuten darauf hin, dass Emotionen während des gesamten Entscheidungsprozesses wahrscheinlich eine informative Rolle spielen. Die Ergebnisse zeigen, dass die Gruppe, die die Infografik erhielt, mit höherer Wahrscheinlichkeit investierte, was die Ergebnisse von Lagazio & Querci (2018) unterstützt. Wie von Dey et al. (2017) postuliert, führt ein Crowdfunding-Video nicht zwangsläufig zu höheren Crowdfunding-Chancen. Bemerkenswert ist, dass sich die vermittelnde Rolle der bewussten Beurteilung bei der Ideen- und der Videobewertung unterscheidet und unterschiedliche Auswirkungen auf die Beziehung zwischen den aktuellen Emotionen und dem Ergebnis, also der Investitionsentscheidung und den selbstberichteten Emotionen, zeigt. Diese Ergebnisse stehen im Einklang mit der Annahme von System-1- und System-2-Denken (Kahneman, 2011). Darüber hinaus deutet das Fehlen eines direkten Effekts der aktuellen Emotionen auf das Ergebnis auf das Potenzial einer vollständigen Mediation durch die bewusste Beurteilung hin, was moderne Entscheidungstheorien unterstützt (Lerner et al., 2015; Loewenstein et al., 2001).

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-145274

Buchcover

The Routledge companion to Britain in the twentieth century

Clapson, Mark

Taylor & Francis, 2009

ISBN 978-0-203-87528-5 | 2024-02-15 | 54 Geschichte

e-Medien: https://doi.org/10.4324/9780203875285

Buchcover

The Routledge companion to critical and cultural theory

Routledge Taylor & Francis Group, 2013

ISBN 978-0-203-52079-6 | 2024-02-14 | 11 Soziologie und Kulturwissenschaften

e-Medien: https://doi.org/10.4324/9780203520796

Buchcover

The Routledge companion to cultural property

Routledge Taylor & Francis Group, 2017

ISBN 978-1-315-64103-4 | 2024-02-14 | 58 Fachlich nicht erfasste Objekte

e-Medien: https://doi.org/10.4324/9781315641034

Buchcover

The Routledge handbook of logical empiricism

Routledge Taylor & Francis Group, 2022

ISBN 978-1-138-12200-0 | 2024-02-16 | 04 Philosophie

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 941-Rout [entlehnt]

Buchcover

The significance of archaeological textiles papers of the international online conference 24th- 25th February 2021

The significance of archaeological textiles Online 2021 Veranstaltung

Dr Ludwig Reichert Verlag, 2023

ISBN 978-3-7520-0784-8 | 2024-02-19 | 58 Fachlich nicht erfasste Objekte

Fachbibliothek Altertumswissenschaften: Freihand, 650/NF 1280 F732 A6-28 [verfügbar]

Buchcover

The spirit in Romans 8 : Paul, the Stoics and Jewish authors in dialogue

Kowalski, Marcin ca. 20./21. Jh.

Vandenhoeck & Ruprecht, 2024

ISBN 978-3-666-50020-6 | 2024-03-01 | 06 Religion, Theologie

e-Medien: https://doi.org/10.13109/9783666500206

Buchcover

The Text Decides Who’s In or Out – A Communicative Perspective on Organizing Situational Membership

Leybold, Milena

2023

2024-02-29 | 58 Fachlich nicht erfasste Objekte


Beschreibung: eng: Membership is an omnipresent phenomenon: people are members of a firm, a university, or a sports club. By signing a contract, enrolling in a study program, or subscribing to a club membership, they become formal members and are administratively tied to such organizations until the membership is formally terminated. However, this rather static understanding of membership does not fully account for formal members’ participation in organizing activities. Building upon more processual and situational perspectives on membership, this cumulative dissertation views membership as a formal and situational phenomenon. Situational membership is accomplished when formal members are authorized to contribute a communicative act to an organizing activity. I apply a ‘communication constitutes organization’ (CCO) perspective to theorize situational membership as a precarious accomplishment that is communicatively constituted by contributions from formal members, external voices, and texts. With a particular focus on decision communication and authoritative texts inscribing the conditions of situational membership, the cumulative dissertation investigates the communicative constitution of situational membership through three qualitative case studies in various contexts. Article 1 investigates the negotiation of situational membership at the big tech company Google, Article 2 at the social media platform Instagram, and Article 3 at a small communal service provider. The dissertation unpacks how decisions on situational membership constitute entry points for negotiating the conditions of situational membership and sheds light on the interactive processes of establishing as well as challenging and resisting a dominant reading of an authoritative text. Further, the dissertation shows how external voices contribute social expectations to the negotiation of situational membership, making it a polyphonic phenomenon.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-143360

Buchcover

The war that must not occur

Dupuy, Jean-Pierre

Stanford University Press, 2023

ISBN 978-1-5036-3665-1 | 2024-02-28 | 58 Fachlich nicht erfasste Objekte


Beschreibung: The possibility of a nuclear war that could destroy civilization has influenced the course of international affairs since 1945, suspended like a sword of Damocles above the heads of the world's leaders. The fact that we have escaped a third world war involving strategic nuclear weapons - indeed, that no atomic weapon of limited power has yet been used under battlefield conditions - seems nothing short of a miracle. Revisiting debates on the effectiveness and ethics of nuclear deterrence, Jean-Pierre Dupuy is led to reformulate some of the most difficult questions in philosophy. He develops a counterintuitive but powerful theory of apocalyptic prophecy: once a major catastrophe appears to be possible, one must assume that it will in fact occur. Dupuy shows that the contradictions and paradoxes riddling discussions of deterrence arise from the tension between two opposite conceptions of time: one in which the future depends on decisions and strategy, and another in which every occurring event is one that could not have failed to occur. Considering the immense destructive power of nuclear warheads and the almost unimaginable ruin they are bound to cause, Dupuy reaches a provocative conclusion: whether they bring about good or evil does not depend on the present or future intentions of those who are in a position to use them. The mere possession of nuclear weapons is a moral abomination.

e-Medien: https://doi.org/10.1515/9781503636651

Buchcover

Theologisieren mit Jugendlichen ein Programm für Schule und Kirche

Dieterich, Veit-Jakobus

Calwer, 2012

ISBN 978-3-7668-4225-1 | 2024-02-07 | 06 Religion, Theologie

Fachbibliothek Theologie: Freihand, RP 01-120 DIET [verfügbar]

Buchcover

Thirteen steps down

Rendell, Ruth,,

Arrow Books, 2005

ISBN 978-0-09-947432-6 | 2024-02-12 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742778 [verfügbar]

Buchcover

Tiefenresonanz Klang, Körper und die Erfahrung sonischer Materialität von Drone Music

Wolf, Luise

Transcript, 2022

ISBN 978-3-8376-6057-9 | 2024-02-26 | 58 Fachlich nicht erfasste Objekte

Bibliothek Haus der Musik: Freihand, G.76-4 [reserviert]

Buchcover

To the ends of the earth a grand tour for the 21st century

Weller, Richard

Birkhäuser, 2024

ISBN 978-3-0356-2793-0 | 2024-02-12 | 42 Architektur

Bibliothekszentrum West: Freihand, 800/ZH 9300 W448 [verfügbar]

Buchcover

Tra principi del diritto penale e teoria del reato per Giovannangelo De Francesco : atti del convegno, Pisa, 6 maggio 2022

Pisa University Press, 2022

ISBN 978-88-3339-745-0 | 2024-02-08 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Strafrecht, [verfügbar]

Buchcover

Tracce svolte di diritto civile esame avvocato

Giuffrè Francis Lefebvre, 2023

ISBN 978-88-288-4780-9 | 2024-02-16 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Transfer pricing and business restructurings current developments, relevant issues and possible solutions

WU Transfer Pricing Symposium Wien 2022

Linde, 2023

ISBN 978-3-7073-4867-5 | 2024-02-20 | 08 Recht


Beschreibung: Transfer pricing and business restructurings: issues and developments In the ever-evolving global landscape, the ability of businesses to swiftly adapt is crucial for maintaining relevance and competitiveness. This imperative holds true for multinationals, which frequently engage in strategic restructuring of their operations, assets, and resources to realign with the dynamic shifts in market conditions. This dynamic approach enhances operational efficiency, cuts costs, and optimizes financial performance. However, the intricacies of restructuring, especially in the context of transfer pricing, pose considerable challenges. Despite elaborate guidance from the OECD and UN, transfer pricing considerations in business restructuring remain complex. Determining appropriate transfer pricing methodologies, finding comparable transactions, and ensuring accurate documentation present hurdles for both multinationals and tax administrations. (https://www.buchhandel.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 445-Tran|b [verfügbar]

Buchcover

Transformation of Intra-organizational Information Management in the Humanitarian Sector The Case of MSF Belgium

Verlooy, Victorine

2024

2024-02-15 | 58 Fachlich nicht erfasste Objekte


Beschreibung: eng: This research explores the critical role of information management (IM) in humanitarian organizations, emphasizing its indispensable nature in addressing perpetual crises. The study, centered on MSF Belgium's experience, serves as a comprehensive case study in the under-researched domain of IM in humanitarian contexts. Through engagement with key stakeholders, it provides essential perspectives on field needs, highlighting the significance of timely, relevant, and organized information. The research unveils key challenges inherent to the humanitarian context, emphasizing the necessity for tailored IM strategies. It addresses factors such as a diverse workforce and the complexities of urgent, time-sensitive fieldwork. The study proposes potential solutions, including training and empowering local employees, while recognizing the human aspect crucial for successful IM in humanitarian organizations. By revealing deeper issues intrinsic to the nature and objectives of humanitarian work, the findings contribute to the understanding of IM complexities and highlight the ongoing need for nuanced strategies in this domain.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-145525

Buchcover

Trust, Treuunternehmen und besondere Vermögenswidmungen in Liechtenstein Handbuch

Schopper, Alexander

Stämpfli Verlag; Verlag Österreich, 2023

ISBN 978-3-7046-9223-8 | 2024-02-14 | 08 Recht

e-Medien: https://doi.org/10.33196/9783704692238

Buchcover

Tumult und Spiele Theater, Calcio und Karneval im Italien der Renaissance

Burke, Peter

Verlag Klaus Wagenbach, 2023

ISBN 978-3-8031-5194-0 | 2024-02-05 | 54 Geschichte

Hauptbibliothek: Magazin HB, 742794 [verfügbar]

Buchcover

Über die Einflussnahme von Online-Videospielen auf die zwischenmenschlichen Beziehungen von zwölf bis 17-jährigen Jugendlichen.

Schmitt, Samuel

2023

2024-02-15 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Abstractbr /br /Diese Masterarbeit beschäftigt sich mit dem Phänomen der Online-Videospiele und wie Jugendliche zwischen zwölf und 17 Jahren diese nutzen, um miteinander zu kommunizieren. Der Schwerpunkt dieser Arbeit wird dabei auf die sozialen Beziehungen der Jugendlichen gelegt. Der erste Teil der vorliegenden Masterarbeit setzt sich auf einer theoretischen Ebene mit der Forschungsfrage: „Über die Einflussnahme von Online-Videospielen auf die zwischenmenschlichen Beziehungen von zwölf bis 17-jährigen Jugendlichen“ auseinander. Im theoretischen Teil der Arbeit werden Jugend, Freundschaft und Online-Videospiele definiert.br /br /Außerdem werden Erkenntnisse gesammelt, um herauszufinden, inwiefern Online-Videospiele die sozialen Beziehungen von Jugendlichen beeinflussen? Diese Erkenntnisse stammen aus Studien der quantitativen und qualitativen Forschung gleichermaßen und erweitern den Blickwinkel zur Thematik. Dazu gehören unter anderem die ökologische Systemtheorie von Urie Bronfenbrenner, das Beobachtungslernen von Albert Bandura oder das Tauschmodell von Peter Blau. Diese theoretischen Konzepte liefern ein Fundament, auf dem meine qualitative Interviewführung sich stützen kann. Theoretische Konzepte, welche im Rahmen des Forschungsgegenstandes formuliert werden, fließen in den Fragebogen der Interviews mit ein.br /br /Der empirische Teil dieser Forschungsarbeit wird mithilfe von sechs ausgewerteten Interviews durchgeführt. An den leitfadengestützten Interviews beteiligten sich insgesamt elf Jugendliche im Alter von zwölf bis 17 Jahren. Die heranwachsenden Online-Spielerinnen und Spieler wurden nach Absprache in luxemburgischen Jugendhäusern kontaktiert. Für die Auswertung der sechs ausgewählten Interviews wird die qualitative Inhaltsanalyse nach Udo Kuckartz verwendet. Dafür werden die vorliegenden transkribierten Interviews in Haupt- und Subkategorien eingeteilt, welche die Analyse der Textdokumente erleichtern sollen.br /br /Online-Videospiele nehmen im Leben vieler Jugendlicher einen wichtigen Stellenwert ein. Dass die soziale Kommunikation mithilfe von Online-Spielen unter Jugendlichen zum Massenphänomen geworden ist, ist noch recht neu und deswegen auch weniger erforscht. Die Aktualität sowie die Präsenz dieser Thematik, insbesondere für die Alterskohorte der Jugendlichen zeigt, dass ein Forschungsinteresse gegeben ist. Was können wir von den sozialen Beziehungen der jungen Generation lernen und wie beeinflussen Online-Spiele ihre zwischenmenschlichen Interaktionen?

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-142040

Buchcover

Über die Heuchelei Täuschungen und Selbsttäuschungen in der Politik

Lendvai, Paul

Paul Zsolnay Verlag, 2024

ISBN 978-3-552-07391-3 | 2024-02-23 | 09 Politik

Hauptbibliothek: Magazin HB, 742842 [verfügbar]

Buchcover

ÜberLebenswege Erinnerungen und Erfahrungen Schwarzer Deutscher der Nachkriegsgeneration

Malanda, Azziza B.

Peter Lang, 2024

ISBN 978-1-80079-552-5 | 2024-02-08 | 11 Soziologie und Kulturwissenschaften

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 672-Mala [entlehnt]

Buchcover

Überraschungsangriff die Ausschaltung des Bundesamtes für Verfassungsschutz und Terrorismusbekämpfung

Gridling, Peter

Seifert Verlag, 2023

ISBN 978-3-904123-76-1 | 2024-01-31 | 09 Politik

Hauptbibliothek: Freihand, 600/MG 33950 G847 [verfügbar]

Buchcover

Umsatz­steuer-Handbuch 2024

Melhardt, Stefan

Linde Verlag GesmbH, 2024

ISBN 978-3-7073-4917-7 | 2024-02-29 | 08 Recht

e-Medien: https://www.lindedigital.at/plink/ko-ustr2024

Buchcover

Und das soll Liebe sein? wie es gelingt, sich aus einer narzisstischen Beziehung zu befreien

Wardetzki, Bärbel

dtv, 2023

ISBN 978-3-423-26189-0 | 2024-02-09 | 05 Psychologie

Hauptbibliothek: Magazin HB, 742784 [entlehnt]

Buchcover

Underlying factors of interrater agreement on temperament in late childhood : an analysis of teacher, parent and child ratings

Spear, Jana

Masterarbeit, University of Innsbruck, 2023 - Volltext: BibSearch

2024-02-23 | 05 Psychologie

Hauptbibliothek: Magazin HB, DG67793 [verfügbar]

Buchcover

Ungleiche Erinnerungen Deutsche und Polen im 19. und 20. Jahrhundert : Didaktik der deutsch-polnischen Erinnerungsorte

Wochenschau Verlag, 2023

ISBN 978-3-7344-1406-0 | 2024-02-05 | 54 Geschichte

Hauptbibliothek: Freihand, 600/NB 3400 B199 [verfügbar]

Buchcover

Unsere Erde der blaue Planet

Urban, Karl

Tessloff, 2013

ISBN 978-3-7886-2035-6 | 2024-02-23 | 31 Geowissenschaften

Bibliothekszentrum West: Lesesaal, N30717/1 [verfügbar]

Buchcover

Unternehmensrecht

Österreich

LexisNexis, 2024

ISBN 978-3-7007-8693-1 | 2024-02-19 | 08 Recht

Fachbibliothek Recht: Bibliothek für Finanzrecht, [verfügbar]

Buchcover

Unzertrennlich über den Tod und das Leben

Yalom, Irvin D.

btb, Juli 2022

ISBN 978-3-442-77215-5 | 2024-02-12 | 05 Psychologie

Hauptbibliothek: Magazin HB, 742785 [entlehnt]

Buchcover

Upon entropy architectonics of the image in the age of information

Villa, Riccardo Matteo.

Birkhäuser Verlag GmbH, 2024

ISBN 978-3-0356-2767-1 | 2024-02-05 | 42 Architektur

Bibliothekszentrum West: Freihand, 800/ZH 3100 V712 [verfügbar]

Buchcover

Uprjamaja zemlja : stichotvorenija

Mel?nikov, Aleksandr

Guten Morgen Verlag, 2020

ISBN 978-3-948521-00-4 | 2024-01-26 | 19 Slawistik

Hauptbibliothek: Magazin HB, 742687 [verfügbar]

Buchcover

Using behavioural polic's tools to foster firm environments and performance "A literature review"

Abdo, Majd

2023

2024-02-22 | 58 Fachlich nicht erfasste Objekte


Beschreibung: eng: This study examines the impact of Behavioural Economics on individuals and organisations over the past five years, (examining 32 papers on the impact of Behavioural Economics on decision-making and performance improvement in individuals and organizations), with a focus on decision-making and performance improvement. Previous research has attempted to clarify the relationship between Behavioural Economics and performance; recent studies have been limited in their explanatory power. This study utilizes Behavioural Economics as a policy tool while maintaining objectivity throughout. This tool assists organisations in enhancing performance through quality assessments.br /A systematic literature review (SLR) was conducted over the last five years, reviewing 32 papers on the topic. The primary findings indicate that the use of certain Behavioural Economics policy tools, such as the Anchoring associated with cognitive biases, may carry more weight in laboratory settings than in real-world practice. Furthermore, the study suggests that the implementation of Nudges and the examination of prevalent cognitive bi-ases and heuristics in decision-making can have a constructive effect on the behaviours of both firms and individuals. These results can enhance our perception of the importance of behavioural economics in practical settings. They demonstrate its potential to improve performance outcomes, to help make more informed choices, and to create strategic frame-works for enhancing performance. Nonetheless, it should be noted that the study has its limitations. With a Systematic Literature Review there is a higher probability of biases in paper selection and evaluation. Additionally, restricting the search to the English language and only using one database, i.e., Web of Science, are also potential limitations.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-143750

Buchcover

Venice and the radical reformation : Italian anabaptism and antitrinitarianism in European context

Suitner, Riccarda

Vandenhoeck & Ruprecht, Habilitationsschrift, Ludwig-Maximilians-Universität, 2022 - Volltext: https://doi.org/10.13109/9783666500190

ISBN 978-3-666-50019-0 | 2024-03-01 | 06 Religion, Theologie

e-Medien: https://doi.org/10.13109/9783666500190

Buchcover

Ver/störende Orte zum Umgang mit NS-kontaminierten Gebäuden

Tagung Ver-/störende Orte. Zum Umgang mit NS-kontaminierten Gebäuden Innsbruck; Linz 2021

mandelbaum verlag, 2024

ISBN 978-3-99136-019-3 | 2024-02-05 | 54 Geschichte


Beschreibung: Auch 75 Jahre nach dem Ende der NS-Herrschaft lässt sich in Österreich wie auch in Deutschland keine klare Haltung im Umgang mit NS-kontaminierten Gebäuden feststellen. Die Frage nach deren adäquater Nutzung oder auch Nicht-Nutzung ist aktueller denn je. Die Ansprüche an diese verstörenden Bauten sind berechtigterweise groß, manchmal unvereinbar, jedenfalls stets verzahnt mit aktuellen politischen und kulturellen Fragestellungen. Die Notwendigkeit von Beweissicherung und Dokumentation zieht weitere Konsequenzen nach sich, etwa Gedenken und Mahnung, aber auch Bildungsaufgaben. Verkomplizierend kommt hinzu, dass durch die NS-Politik aufgeladene Gebäude seit 1945 multiple Nachnutzungen erfahren haben, die selbst Teil der Rezeptionsgeschichte und Reflexion sein müssen. Historiker:innen, Architekt:innen und Künstler:innen stellen sich der Frage: Wie mit dem (un)sichtbar belastenden Erbe umgehen? Der Band versammelt Texte, Interviews, Fotostrecken und künstlerische Interventionen aus unterschiedlichen Perspektiven.

Bibliothekszentrum West: Freihand, 800/ZH 4746 B671 [verfügbar]

Buchcover

Veränderte Kompetenzanforderungen an Lehrpersonen durch den Einsatz von künstlicher Intelligenz im Unterricht? Erfahrungen und Sichtweisen von kaufmännischen BMHS-Lehrpersonen

Kerber, Maria

2023

2024-02-20 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Der Einsatz von künstlicher Intelligenz (KI) im Klassenzimmer ist ein aktuelles Thema im Bildungsbereich (Becker, 2023; Ostermann, 2023; Vilgut & Zottler, 2023). Besonders der Chatbot ChatGPT erlangt Popularität und führt zu Diskussionen darüber, wie sich Schulen demgegenüber verhalten sollen (Vilgut & Zottler, 2023). Die Schulen stehen vor veränderten Bedingungen, die Anpassungs- und Entwicklungsprozesse erfordern. Hierbei kommt der pädagogischen Professionalität der Lehrer*innen eine entscheidende Rolle zu (Kraler & Schratz, 2007). Ein kritischer und verantwortungsbewusster Umgang mit KI erscheint unerlässlich, um dieser veränderten Lehrer*innenrolle auch in Zukunft gerecht zu werden.br /Zunächst werden in dieser Forschungsarbeit die neuesten Erkenntnisse zu KI im Bildungsbereich aufgezeigt. Es werden verschiedene KI-Systeme vorgestellt, Stärken und Grenzen dieser Technologien erklärt sowie ethische Aspekte beleuchtet. Zudem wird Lehrer*innenprofessionalität anhand der Kompetenzfelder des EPIK-Modells und TPACK-Modells definiert. Grundsätzlich zeigt diese Forschungsarbeit, dass sich die Kompetenzanforderungen an die kaufmännischen Lehrpersonen an österreichischen BMHS trotz der aktuellen Entwicklungen nicht grundlegend verändern. Dennoch wird aus den sieben problemzentrierten Interviews ersichtlich, dass bekannte Fähigkeiten durch den Einsatz von KI vermehrt gefordert werden. Zum einen wird von einer erhöhten Nachfrage nach Fachwissen und Methodenkompetenz gesprochen, zum anderen erscheinen digitale Kompetenzen laut den Interviewpartner*innen so gefordert wie noch nie. Die Lehrpersonen geben an, dass sie sich auf diesen Wandel nicht ausreichend vorbereitet fühlen und dass sie in diesem Prozess von den Schulen weitgehend alleingelassen werden. Um sich an die geforderten Fähigkeiten optimal anpassen zu können, erwarten sich die Lehrpersonen zukünftig Veranstaltungen zu Fort- und Weiterbildung und zeigen Motivation, diese zu besuchen. Von Seiten der jeweiligen Schule wird eine Aufklärung über die Hintergründe, Anwendungsmöglichkeiten und datenschutzrechtlichen Aspekte zu den diversen KI-Tools erwartet. Es bedarf zudem laut Aussagen der Lehrpersonen klarer Richtlinien und Vorgaben im Umgang mit KI im Klassenzimmer, die zum aktuellen Zeitpunkt noch ausbleiben und auch in naher Zukunft nicht geplant sind.

e-Medien: https://ulb-dok.uibk.ac.at/9025654

Buchcover

Verborgenes Leben die artenreiche Tierwelt in der Schorfheide

Steinert, Tim

Natur & Text, 2018

ISBN 978-3-942062-36-7 | 2024-02-09 | 29 Zoologie

Bibliothekszentrum West: Freihand, 800/WI 5335 S822 [verfügbar]

Buchcover

Verbum Dei Recitatum zum Gebrauch der Heiligen Schrift durch ihre gottesdienstliche Lesung

Schulz-Mews, Philipp

Vandenhoeck & Ruprecht / Echter Verlag, 2024

ISBN 978-3-666-50049-7 | 2024-02-27 | 06 Religion, Theologie

e-Medien: https://doi.org/10.13109/9783666500497

Buchcover

Vergleich einer angeleiteten und einer selbstständigen Erfassung von körperlicher Aktivität mittels Global Physical Activity Questionnaire (GPAQ) und die Auswirkungen zweier Analyseverfahren auf das Bewegungsausmaß

Stickel, Nadine

2023

2024-02-15 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Einleitung Um eine genaue Dosis-Wirkungs-Beziehung der Art, des Umfangs und der Intensität von gesundheitsfördernder körperlicher Aktivität aufzustellen, ist die Messung körperlicher Aktivität erforderlich. Häufig wird der Global Physical Activity Questionnaire (GPAQ) zur Beurteilung körperlicher Aktivität verwendet. Er wurde ursprünglich von der World Health Organisation (WHO) für die Verwaltung eines:einer Interviewer:in konzipiert. Das Hauptziel dieser Studie war es, eine Online-Version des GPAQs mit der ursprünglichen, von einem:einer Interviewer:in durchgeführten Version zu vergleichen. Darüber hinaus wurde untersucht, ob sich zwei Analyseverfahren des GPAQs hinsichtlich des Bewegungsausmaßes unterscheiden. br /br /Methodik Es wurden Daten von 553 Teilnehmer:innen aus einer groß angelegten Präventionsstudie (LIFE-Tirol Studie) analysiert. Das Bewegungsverhalten der Teilnehmenden wurde bei der Rekrutierung zur Studie in Form eines persönlichen Interviews durch den GPAQ-Fragebogen erfasst. Kurz vor Interventionsbeginn erhielten sie den gleichen Fragebogen über eine App als Online-Version zum Ausfüllen. Die Bewegungsdomänen und Intensitätsangaben der beiden Versionen wurden geschlechter- und altersspezifisch analysiert. Die Daten der Interviewversion wurde anhand von zwei Analyseverfahren (GPAQ-Analyseguide und WHO-Richtlinien) ausgewertet und verglichen.br /br /Ergebnisse Die Teilnehmer:innen berichteten in der Online-Version signifikant mehr MET-Minuten in allen Domänen F(1,552)= 167, p ,001, ?²¬p= ,232, sowie in der Domäne Arbeit, Fortbewegung und Freizeit, signifikant mehr intensive Intensitätsminuten in allen Domänen F(1,552)= 99,7, p ,001, ?²¬p = ,153, sowie in der Domäne Arbeit und Freizeit und signifikant mehr moderate Intensitätsminuten in allen drei Domänen F(1,552)= 101,0, p ,001, ?²¬p = ,155, sowie in der Domäne Arbeit, Fortbewegung und Freizeit. Das Geschlecht und die Alterskategorien beeinflussten die Ergebnisse größtenteils nicht, nur in der Domäne Freizeit. Das männliche Geschlecht berichtete über mehr intensive Intensitätsminuten und die Proband:innen der Alterskategorie 55 und älter berichteten über mehr moderate Intensitätsminuten und MET-Minuten in beiden Versionen. Die Analyseverfahren unterschieden sich nur in der Gruppe der inaktiv eingestuften Personen signifikant U= 15313,00, p ,001.br /br /Diskussion Die Ergebnisse können mit dem Auftreten verschiedener Messfehler von selbstverwalteten Messinstrumenten begründet werden. Insbesondere die Vor- und Nachteile der beiden Erhebungsformen könnten mögliche Erklärungen für die Unterschiede dieser sein. Außerdem kann angenommen werden, dass der Zeitraum zwischen den Erhebungsformen möglicherweise zu Verzerrungen der Ergebnisse führen kann. Der Unterschied der beiden Analyseverfahren ist möglicherweise auf die Mindestanzahl an Tage pro Woche, die laut des GPAQ-Analyseguides vorgegeben ist, zurückzuführen. Dies führt zu einer Diskussion, ob die Tage eine Rolle spielen, wenn es um die gesundheitlichen Vorteile körperlicher Aktivität geht. Die Ergebnisse können als Grundbaustein für weitere Untersuchungen verschiedener Erhebungsformen und Analyseverfahren genommen werden.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-143396

Buchcover

Vergleich zwischen numerischer und experimenteller Partikelverfolgung in Lawinensimulationen

Höller, Jan Frederik

2023

2024-02-29 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Die vorliegende Masterarbeit widmet sich dem Vergleich zwischen numerischer und experimenteller Partikelverfolgung in Lawinensimulationen. Ziel dieser Untersuchung war es festzustellen, inwieweit die Bewegung von numerischen Partikeln in Lawinensimulationen mit der Bewegung von realen Messkörpern vergleichbar ist. Die innerhalb dieser Arbeit analysierten numerischen Lawinensimulationen wurden mit dem Berechnungsmodul für dichte Fließlawinen com1DFA der Simulationssoftware AvaFrame berechnet. Für die Durchführung eines standardisierten Vergleichs wurden die Partikelergebnisse mithilfe der implementierten Methode AIMEC in das sogenannte Thalweg-Koordinatensystem transformiert. Anschließend konnten die Simulationsergebnisse mit den Messergebnissen von partikelbasierten in-flow Messungen verglichen werden. Die Analyse der Partikelbewegung konzentrierte sich auf drei Messgrößen: die maximale Partikelfließgeschwindigkeit, die maximale absolute Partikelposition und der relative Partikelabstand zum Massenschwerpunkt. Erste Informationen über die Lawinenbewegung liefert die Auswertung der zeitlichen und räumlichen Entwicklung der Geschwindigkeitsdichteverteilungen. Darauf aufbauend, konnte das für die Lawinensimulationen verwendete Reibungsmodell im Vergleich zu den Messdaten optimiert werden. In einem nächsten Schritt wurden die Partikelergebnisse im Auslöse- und Auslaufgebiet visualisiert. Weitere Informationen lieferte die Ergebnisauswertung mit dem erweiterten Thalweg-Zeit-Diagramm, welches die Darstellung der zeitlichen Bewegung eines Partikels entlang des Thalwegs mit der Visualisierung einer Ergebnisgröße kombiniert. Als Ergebnis zeigte sich, dass die maximalen Geschwindigkeiten eines numerischen Partikels gut mit den Messungen übereinstimmen können, vorausgesetzt, die Reibungsparameter sind ausreichend gut angepasst. Zusätzlich konnte aus der Position eines numerischen Partikels im Ablagerungsgebiet auf dessen maximale Fließgeschwindigkeit geschlossen werden. Die Unterschiede bei den geometrischen Ergebnisgrößen waren hingegen zu groß, um ein ähnliches Verhalten zwischen Numerik und Messung zu erkennen. Die in dieser Arbeit entwickelten Methoden bieten einen vielversprechenden Ansatz zur Evaluierung und Verbesserung von numerischen Lawinensimulationen. Darüber hinaus konnte gezeigt werden, dass ein Vergleich zwischen den Ergebnissen von Simulationen mit realen Messungen neue Einblicke in das Fließverhalten von Lawinen liefern kann. Durch die Analyse der Partikelbewegungen konnte die Genauigkeit von Lawinensimulationen charakterisiert und anschließend wesentliche Modellparameter optimiert werden. Die entwickelten Methoden haben das Potenzial die Grundlage für zukünftige Forschungsarbeiten im Bereich der Partikelverfolgung in Lawinensimulation zu legen.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-142268

Buchcover

Verhandlungen des Einundzwanzigsten Österreichischen Juristentages Wien 2022

Österreichischer Juristentag Wien 2022 21.

MANZ'sche Verlags- und Universitätsbuchhandlung, 2023

ISBN 978-3-214-25166-6 | 2024-02-15 | 08 Recht

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Verhandlungen des Einundzwanzigsten Österreichischen Juristentages Wien 2022

Österreichischer Juristentag Wien 2022 21.

MANZ'sche Verlags- und Universitätsbuchhandlung, 2024

ISBN 978-3-214-25164-2 | 2024-02-15 | 08 Recht

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Verhandlungen des Einundzwanzigsten Österreichischen Juristentages Wien 2022

Österreichischer Juristentag Wien 2022 21.

MANZ'sche Verlags- und Universitätsbuchhandlung, 2023

ISBN 978-3-214-25165-9 | 2024-02-15 | 08 Recht

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Verhandlungen des Einundzwanzigsten Österreichischen Juristentages Wien 2022

Österreichischer Juristentag Wien 2022 21.

MANZ'sche Verlags- und Universitätsbuchhandlung, 2023

ISBN 978-3-214-25168-0 | 2024-02-15 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Verhandlungen des Einundzwanzigsten Österreichischen Juristentages Wien 2022

Österreichischer Juristentag Wien 2022 21.

MANZ'sche Verlags- und Universitätsbuchhandlung, 2023

ISBN 978-3-214-25167-3 | 2024-02-15 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Verkehr und Tourismus eine Einführung mit Fallstudien

Dorsch, Monique

UVK Verlag, 2024

ISBN 978-3-8252-6195-5 | 2024-02-26 | 12 Volkswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 229-Dors|b [verfügbar]

Buchcover

Verschachtelt und (v)erschlossen Gefühlserkundungen im Archiv

Literaturedition Niederösterreich, 2023

ISBN 978-3-902717-73-3 | 2024-02-08 | 03 Information und Dokumentation, Buch- und Bibliothekswesen

Brenner-Archiv: Bibliothek, IV-1136 [verfügbar]

Buchcover

Víctor Rahola

Rahola, Victor

Verlag der Buchhandung Walther und Franz König, 2023

ISBN 978-3-7533-0487-8 | 2024-02-07 | 42 Architektur


Beschreibung: Diese Monografie umfasst die jüngsten Arbeiten des Studios von Víctor Rahola aus Barcelona (auch in seiner Zeit als Partner von Jorge Vidal) - von der Erweiterung der Bibliothek der Biologischen Fakultät der Universität Barcelona über die Weinkellereien in Mont-Ras bis hin zu verschiedenen Hotels auf den Balearen. Zusätzlich zu den Werken reflektieren drei Texte des Architekten über wichtige Themen der zeitgenössischen Architektur, insbesondere im Mittelmeerraum.

Bibliothekszentrum West: Freihand, 800/ZH 4800 R148 [verfügbar]

Buchcover

Villa Metaphora Roman

De Carlo, Andrea

Diogenes, 2015

ISBN 978-3-257-06938-9 | 2024-02-26 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742854 [verfügbar]

Buchcover

Vita & Virginia

Lavizzari, Alexandra

ebersbach & simon, 2022

ISBN 978-3-86915-259-2 | 2024-02-26 | 16 Anglistik und Amerikanistik

Hauptbibliothek: Magazin HB, 742841 [verfügbar]

Buchcover

Vivere nella dimensione digitale dai diritti del cittadino alla responsabilità dei data processors

D'Agostino Panebianco, Manlio

Themis, 2022

ISBN 978-88-96069-50-9 | 2024-02-23 | 08 Recht

Fachbibliothek Recht: Bibliothek für Italienisches Privatrecht, [verfügbar]

Buchcover

Vögel im Harz Artenreichtum eines kleinen Gebirges

Günther, Egbert

Natur + Text, 2021

ISBN 978-3-942062-49-7 | 2024-02-08 | 29 Zoologie

Bibliothekszentrum West: Freihand, 800/WS 1020 G927(2) [verfügbar]

Buchcover

Volker Braun

edition text + kritik, 2023

ISBN 978-3-96707-874-9 | 2024-02-27 | 17 Germanistik, Skandinavistik, Niederlandistik

Hauptbibliothek: Magazin HB, 388633 [verfügbar]

Buchcover

Vom Fremden erzählen Reiseberichte aus fünf Jahrhunderten : Katalog zur Ausstellung der Forschungsbibliothek Gotha auf Schloss Friedenstein vom 16. April bis 11. Juni 2023

Forschungsbibliothek Gotha der Universität Erfurt, 2023

ISBN 978-3-910027-42-8 | 2024-02-16 | 03 Information und Dokumentation, Buch- und Bibliothekswesen

Hauptbibliothek: Sondersammlungen Lesesaal, 388628 [verfügbar]

Buchcover

Vorarlberger Baugesetz Texte, Materialien, Judikatur

proLIBRISat, 2023

ISBN 978-3-99099-626-3 | 2024-02-12 | 08 Recht

Bibliothekszentrum West: Freihand, 800/PN 981.587 P964(8) [verfügbar]

Buchcover

Vorwärts ohne Gleichschritt zwanzig Jahre Europäische Linke : eine Flugschrift

VSA Verlag, 2023

ISBN 978-3-96488-206-6 | 2024-01-29 | 09 Politik

Hauptbibliothek: Magazin HB, 355442 [verfügbar]

Buchcover

Vulkane Feuer aus der Tiefe

Tessloff, 2013

ISBN 978-3-7886-2044-8 | 2024-02-19 | 31 Geowissenschaften

Bibliothekszentrum West: Lesesaal, N30717/57 [verfügbar]

Buchcover

Wählermärkte : Wahlverhalten und Regierungspolitik in der Berliner Republik

Korte, Karl-Rudolf

Campus, 2024

ISBN 978-3-593-51835-0 | 2024-02-19 | 09 Politik


Beschreibung: Wie regiert die Berliner Ampel? Was haben Scholz, Habeck, Baerbock und Lindner aus dem Votum der Wähler gemacht? Was geschieht nach Bundestagswahlen mit unserer abgegebenen Stimmé Nach welchen Kriterien entscheiden die Deutschen überhaupt, wen sie wählen? Und wie stellen sich die politischen Akteure darauf ein? Karl-Rudolf Korte, einer der besten Kenner des politischen Betriebs der Bundesrepublik, geht diesen Fragen anhand der Metapher des Wochenmarktes auf den Grund. Denn Märkte sind Gespräche, sie sind der Grundstoff für die Beziehungen zwischen Wählern und Politikern. Die pragmatischen Deutschen sind – so Korte in diesem pointiert formulierten Essay – sicherheitsorientiert. Sie wählen mehrheitlich politisch moderat und mittig, sie sind eingebunden in den Westen und lassen sich eher von aufregungsresistenten Amtsinhabern als von Populisten regieren. Wenngleich Wähler extremer Parteien, Nicht-Wähler, Protestbewegungen und autoritäre Versuchungen durch manipulative Unwahrheiten auch in Deutschland zunehmen: Korte plädiert aus seiner langjährigen Wahlforschung heraus, künftigen Wahlen in Deutschland mit Gelassenheit und Zuversicht entgegenzusehen. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 739-Kort [verfügbar]

Buchcover

Wald mehr als nur Bäume

Hackbarth, Annette

Tessloff, 2014

ISBN 978-3-7886-2088-2 | 2024-02-26 | 27 Biologie allgemein

Bibliothekszentrum West: Lesesaal, N30717/134 [verfügbar]

Buchcover

Waldbetretung und Waldaufenthalt ein Recht und seine Schranken

Kaschka, Jonas

new academic press, 2024

ISBN 978-3-7003-2314-3 | 2024-02-22 | 08 Recht

Fachbibliothek Recht: Bibliothek für Öffentliches Recht, Staats- und Verwaltungslehre, [verfügbar]

Buchcover

Walter von Lom Einpassung und Eigensinn : Bauten und Entwürfe : 1972–2012

Lom, Walter von

Verlag der Buchhandlung Walther und Franz König, 2023

ISBN 978-3-7533-0486-1 | 2024-02-07 | 42 Architektur


Beschreibung: Der Architekt Walter von Lom gründet 1972 sein Büro in Köln. Bekannt wird er mit der sensiblen Einpassung zeitgenössischer Architektur in historischen Bestand. In den folgenden vierzig Jahre erweitert sich das Aufgaben-spektrum auf zahlreiche Bauaufgaben in unterschiedlichen Dimensionen, dazu gehören das Wohn- und Bürohaus in der Rheingasse (Köln 1972–1974), die Kirche St. Marien Heimsuchung (Herten 1972–1977), die Instandsetzung des Museums für Angewandte Kunst Köln (1985–1989), der Umbau einer Lagerhalle zum Deutschen Sport und Olympia Museum (Köln 1996–1999), die Bibliothek des Weltwirtschaftsinstituts (Kiel 1996–2001) – und zahlreiche, preisgekrönte Einrichtungen für Senioren. Unabhängig von Typologie und Maßstab ist Architektur für Walter von Lom dabei immer auch ein Beitrag zur Gestalt der Stadt.

Bibliothekszentrum West: Freihand, 800/ZH 4800 L839 [verfügbar]

Buchcover

Wege aus Verhaltensfallen Pädagogisches Handeln in schwierigen Situationen

Hehn-Oldiges, Martina ca. 20./21. Jh.

Beltz, 2024

ISBN 978-3-407-63317-0 | 2024-02-08 | 07 Pädagogik


Beschreibung: Wenn Lehr- und Fachkräfte in pädagogischen Situationen zu scheitern drohen, können sie schnell in Verhaltensfallen geraten, aus denen sie nicht ohne Weiteres herausfinden. Dieses Buch hilft ihnen dabei, solche Verhaltensfallen zu erkennen und zu überwinden. Sie erfahren, wie sie herausfordernde Verhaltensweisen bei Kindern und Jugendlichen analysieren und ihnen professionell begegnen können. Nicht der als »störend« erlebte Mensch steht dabei im Fokus, sondern die pädagogische Situation und ihre Beteiligten werden in der jeweiligen Beziehungsdynamik betrachtet. Dabei geht die Autorin auch auf die Entwicklung sozioemotionaler Fähigkeiten und mögliche Beeinträchtigungen ein, etwa (»geistige«) Behinderungen, besondere Belastungen, veränderte Wahrnehmungen und deren Auswirkung auf das Verhalten. Ziel des Buches ist es, auch in schwierigen Situationen gute pädagogische Beziehungen zu erhalten oder wiederaufzubauen – orientiert an den Reckahner Reflexionen zur Ethik pädagogischer Beziehungen. (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 583-Hehn [verfügbar]

Buchcover

Weiße Fracht Lost in Fuseta : ein Portugal-Krimi

Ribeiro, Gil

Kiepenheuer & Witsch, 2019

ISBN 978-3-462-05268-8 | 2024-01-26 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742728 [verfügbar]

Buchcover

Weiße Rentierflechte

Nerkagi, Anna Pavlovna

Faber & Faber, 2021

ISBN 978-3-86730-197-8 | 2024-01-30 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742685 [verfügbar]

Buchcover

Welfare chauvinism in Europe how education, economy and culture shape public attitudes

Eick, Gianna Maria

Edward Elgar Publishing, 2024

ISBN 978-1-80392-552-3 | 2024-02-21 | 09 Politik

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 704-Eick [entlehnt]

Buchcover

Welt der Bakterien, Archaeen und Viren ein einführendes Lehrbuch der Mikrobiologie

Gottschalk, Gerhard

Wiley-VCH, 2015

ISBN 978-3-527-33676-0 | 2024-02-06 | 27 Biologie allgemein

Bibliothekszentrum West: Freihand, 800/WF 1000 G687+3 [verfügbar]

Buchcover

Werbung und Recht : Festschrift für Gerhard Ring

Nomos, 2023

ISBN 978-3-7560-1091-2 | 2024-02-02 | 08 Recht

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Whistleblowing & Internal Investigations Praxiskommentar zu HSchG und Whistleblowing-Richtlinie

LexisNexis, 2024

ISBN 978-3-7007-8312-1 | 2024-02-09 | 08 Recht

Fachbibliothek Recht: Bibliothek für Öffentliches Recht, Staats- und Verwaltungslehre, [verfügbar]

Buchcover

Wie fördert Abenteuersport das eudaimonische subjektive Wohlbefinden?

Rakut, Raphael

2023

2024-02-22 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Houge Mackenzie und Hodge (2020) konzipierten ein theoretisches Rahmenmodell, das den Wirkmechanismus der Ausübung von Abenteuersport auf das eudaimonische Wohlbefinden durch die beiden Mediatoren Naturverbundenheit und Befriedigung der psychologischen Grundbedürfnisse erklären soll. Das Ziel dieser Arbeit war, dieses theoretische Rahmenmodell empirisch zu evaluieren. Dazu wurden 104 Personen per Online-Fragebogen befragt, die entweder Abenteuersport (Skitouren gehen, Freeriden, Enduro oder Downhill Mountainbike) oder Hallensport (Basketball und Handball) ausübten. Das theoretische Rahmenmodell konnte durch eine Mediationsanalyse zum Teil bestätigt werden. Während die Naturverbundenheit bei der Ausübung von Abenteuersport einen entscheidenden Einfluss auf das eudaimonische Wohlbefinden hatte, konnte die Befriedigung der psychologischen Grundbedürfnisse den positiven Einfluss von Abenteuersport auf das eudaimonische Wohlbefinden nicht erklären. Die Befunde helfen, die Wirkmechanismen des Abenteuersports auf das Wohlbefinden zu verstehen und regen dazu an, in zukünftigen Untersuchungen besonders auf die Rolle der Befriedigung der psychologischen Grundbedürfnisse als Einflussgröße zwischen Abenteuersport und eudaimonischen Wohlbefinden näher einzugehen.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-143781

Buchcover

Wie man einen Traum aufgibt, um ein Leben zu gewinnen

Langmann, Nico

Brandstätter, 2023

ISBN 978-3-7106-0687-8 | 2024-02-06 | 49 Sport und Spiele

Sportwissenschaft: Freihand, 621/6265 [verfügbar]

Buchcover

Wie man mit Haien schwimmt : eine Liebeserklärung

Sarano, François

Folio Verlag, 2023

ISBN 978-3-85256-889-8 | 2024-02-16 | 29 Zoologie

Hauptbibliothek: Magazin HB, 742850 [verfügbar]

Buchcover

Wie Raumqualitäten entstehen Erfahrungsräume in Kindertageseinrichtungen

Zirves, Michèle

Juventa Verlag ein Imprint der Julius Beltz GmbH & Co KG, 2023

ISBN 978-3-7799-7198-6 | 2024-02-12 | 42 Architektur

Bibliothekszentrum West: Freihand, 800/ZH 6100 S855 [verfügbar]

Buchcover

Wien Museum/neu

Czaja, Wojciech

müry salzmann, 2023

ISBN 978-3-99014-249-3 | 2024-02-12 | 42 Architektur

Bibliothekszentrum West: Freihand, 800/ZH 6230 F318 [verfügbar]

Buchcover

Wilde Jagd Roman

Freund, René

Paul Zsolnay Verlag, 2023

ISBN 978-3-552-07367-8 | 2024-02-16 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742797 [verfügbar]

Buchcover

Winterkrieg Roman

Tuuri, Antti,,

Kiepenheuer, 1992

ISBN 978-3-378-00504-4 | 2024-02-26 | 56 Belletristik und Spielfilme

Hauptbibliothek: Magazin HB, 742856 [verfügbar]

Buchcover

"Wir machen Bücher" 450 Jahre Herzog August Bibliothek

Harrassowitz Verlag; Herzog August Bibliothek, 2023

ISBN 978-3-447-12039-5 | 2024-02-08 | 03 Information und Dokumentation, Buch- und Bibliothekswesen

Hauptbibliothek: Sondersammlungen Lesesaal, 355449 [verfügbar]

Buchcover

Wirkfaktoren der Achtsamkeit : wie sie die Psychotherapie verändern und bereichern

Harrer, Michael E.,,

Schattauer, 2019

ISBN 978-3-608-42825-4 | 2024-02-21 | 05 Psychologie

Hauptbibliothek: Freihand, 600/CU 8000 H296 [verfügbar]

Buchcover

Wirtschaft für Kids eine etwas andere Einführung in die Ökonomie

Hagelüken, Alexander

CHBeck, 2023

ISBN 978-3-406-80791-6 | 2024-02-19 | 10 Wirtschafts- und Sozialwissenschaften allgemein

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 101-Hage [reserviert]

Buchcover

Wirtschaftsmärchen hundertundeine Legende über Ökonomie, Arbeit und Soziales

Schreiner, Patrick

PapyRossa Verlag, 2023

ISBN 978-3-89438-814-0 | 2024-02-19 | 10 Wirtschafts- und Sozialwissenschaften allgemein

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 641-Schr [verfügbar]

Buchcover

Wirtschaftsmathematik

Kirsch, Siegfried

Kiehl, 2023

ISBN 978-3-470-54506-6 | 2024-02-26 | 23 Mathematik, Statistik

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 901-Kirs [verfügbar]

Buchcover

Wirtschaftsvölkerrecht

Krajewski, Markus

CF Müller, 2021

ISBN 978-3-8114-5475-0 | 2024-02-12 | 08 Recht

Fachbibliothek Recht: Bibliothek für Europarecht, [verfügbar]

Buchcover

Wissenschaft und Datenschutz Sechste Jahrestagung Räume und Identitäten des Fachbereichs Öffentliches Recht

Jahrestagung Räume und Identitäten Salzburg 2023 6.

Jan Sramek Verlag, 2024

ISBN 978-3-7097-0358-8 | 2024-02-09 | 08 Recht

Fachbibliothek Recht: Bibliothek für Öffentliches Recht, Staats- und Verwaltungslehre, [verfügbar]

Buchcover

Wissenszurechnung im österreichischen Kapitalgesellschaftsrecht

Grasser, Philipp

Verlag Österreich, 2023

ISBN 978-3-7046-9250-4 | 2024-02-09 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Wo der spitzeste Zahn der Karawanken in den Himmel hinauf fletscht Roman

Jost, Julia

Suhrkamp, 2024

ISBN 978-3-518-43167-2 | 2024-02-15 | 56 Belletristik und Spielfilme

Hauptbibliothek: Freihand, 600/GO 80000 J84 W83.2024 [verfügbar]

Buchcover

Wohlstandssicherung durch freiwillige Längerbeschäftigung juristische und ökonomische Fragen der Pensionierung von Universitätsprofessoren

Wohlstandssicherung durch freiwillige Längerbeschäftigung Augsburg; Online 2023 Veranstaltung

Mohr Siebeck, 2023

ISBN 978-3-16-162739-2 | 2024-02-19 | 08 Recht

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Woke : Psychologie eines Kulturkampfs

Bockwyt, Esther

Westend, 2024

ISBN 978-3-86489-444-2 | 2024-02-19 | 05 Psychologie


Beschreibung: Was als linke Identitätspolitik einst progressiv gedacht war, hat längst die Schwelle zu einer militanten Ideologie überschritten, analysiert die Psychologin Esther Bockwyt. Auf Basis einer pauschalen Einteilung von Menschen in Opfergruppen und Privilegierte wird abgeleitet, wer was wann sagen oder tun darf. So kritisch wie ausgewogen und vor allem fernab der schrillen Tonlagen des Feuilletons erfasst Bockwyt das Thema Wokeness erstmals aus psychologischer Perspektive und fragt: Wie ist eine "woke Psyche" verfasst, wenn Narzissmus, Gewissenhaftigkeit oder Aggression ein gesundes Maß überschreiten? Wie entsteht im Zusammenspiel mit Gruppendynamiken überhöhte Meinungskontrolle, die zur Cancel Culture, also dem Boykott von Personen, Gruppen oder Kultur, führen kann? (https://www.amazon.de)

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 952-Bock [verfügbar]

Buchcover

Wolf Biermann ein Lyriker und Liedermacher in Deutschland

Ch Links Verlag, 2023

ISBN 978-3-96289-195-4 | 2024-02-01 | 17 Germanistik, Skandinavistik, Niederlandistik

Hauptbibliothek: Magazin HB, 742726 [verfügbar]

Buchcover

Workflows zwischen BIM und AVA-Programmen im Brückenbau

Riedl, Simon

2024

2024-02-22 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Der konventionelle Planungsprozess im Brückenbau ist heute (Januar 2024) häufig noch die zweidimensionale Planung komplexer Bauwerke und die händische Berechnung der Massen durch Interpolation von Querschnitten mit Hilfe von Stift und Taschenrechner. Aus den ermittelten Massen wird ein Leistungsverzeichnis befüllt. Im Rahmen dieser Masterarbeit wird überprüft, wie diese Methode durch Building Information Modelling (BIM) ersetzt werden kann, denn BIM ermöglicht prinzipiell die automatische Erstellung von Leistungsverzeichnissen (LVs) aus Bauteilinformationen. Deshalb geht diese Arbeit folgenden Fragen nach: Wie weit ist die Softwarelandschaft im Bauwesen und im Speziellen im Brückenbau, um Informationsaustausch zwischen BIM- und AVA-Software zu meistern? Kann das oft noch gängige Auswerten von Massen anhand von zweidimensionalen Plänen über Interpolation zwischen Querschnitten mit der Hand oder dem Taschenrechner durch BIM ersetzt werden? br /br /Hierfür wird ein Testprojekt in unterschiedlichen Modellierungssoftwares erstellt und die benötigten Schritte detailliert dokumentiert. Erstens wird für die Modellierung die Möglichkeiten der Programme betrachtet, entlang einer Achse eine Brücke zu erstellen. Zweitens werden die Features der Programme, diese Brücke mit alphanumerischen Informationen zu bestücken, aufgezeigt, da ein dreidimensionales Planungsmodell erst durch das Hinzufügen von alphanumerischen Informationen zu BIM werden kann. Diese Informationen ermöglichen in weiterer Folge den BIM-Workflow in den AVA-Programmen.br /br /In dieser Arbeit werden die Prozesse der AVA-Programme vom Import bis zum fertigen Leistungsverzeichnis für die unterschiedlichen Modelle detailliert beschrieben und daraus Workflows definiert. Dabei werden die Standardworkflows der Programme für den Brückenbau und die importierten Modelle adaptiert.br /br /Diese Arbeit soll eine Anleitung für die Programme und einen Überblick über den derzeitigen Stand (Januar 2024) des BIM-Workflows von der Modellierung bis zum LV bieten und weiters praxisgerechte Workflows für die AVA-Programme aufzeigen. Die Modellierung und die AVA-Workflows werden miteinander verglichen, um daraus die beste Lösung für den speziellen Anwendungsfall Brückenbau dieser Arbeit zu finden. Die Bewertung der Programme bezieht sich lediglich auf den Anwendungsfall dieser Arbeit. Damit soll diese Thesis Basis für weitere Entwicklungen sein.

e-Medien: https://resolver.obvsg.at/urn:nbn:at:at-ubi:1-144649

Buchcover

Writings 1997-2003

Cybernetic Culture Research Unit

Urbanomic, 2017

ISBN 978-0-9954550-6-1 | 2024-01-30 | 04 Philosophie

Hauptbibliothek: Magazin HB, 742759 [verfügbar]

Buchcover

Wüsten Nomaden, Oasen und endlose Weiten

Werdes, Alexandra

Tessloff, 2015

ISBN 978-3-7886-2091-2 | 2024-02-19 | 31 Geowissenschaften

Bibliothekszentrum West: Lesesaal, N30717/34 [verfügbar]

Buchcover

Wunderhafte Embryos moderne Naturwissenschaft und ungeborenes Leben im Islam

Guénon, Melanie

Nomos; Ergon, 2023

ISBN 978-3-98740-103-9 | 2024-02-19 | 11 Soziologie und Kulturwissenschaften

e-Medien: https://doi.org/10.5771/9783987401039

Buchcover

Wunderheiler Stammzelle Konzeption eines interaktiven, forschungsnahen Workshops anhand biomedizinischer und -ethischer Fragestellungen für die Sekundarstufe II

Leitner, Janine

2023

2024-02-29 | 58 Fachlich nicht erfasste Objekte


Beschreibung: ger: Die Molekularbiologie als Forschungsgebiet der Biomedizin revolutioniert die biologische Grundlagenforschung und bildet die Basis für die Entwicklung neuartiger therapeutischer Ansätze, vor allem in der regenerativen Medizin. Die Covid-19 Pandemie hat gezeigt, dass ein grundlegendes naturwissenschaftliches Verständnis für alle Menschen erstrebenswert ist, um eine aktive Partizipation an einer von empirischen Erkenntnissen geprägten Gesellschaft zu ermöglichen. Deshalb muss ein Bildungsziel der Schule sein einen aufklärenden, integrierenden Naturwissenschaftsunterricht zu gestalten, der den SchülerInnen adäquate Fähigkeiten und Fertigkeiten für die Auseinandersetzung mit entstehenden Socio-scientific Issues vermittelt. Während im alten Lehrplan Biologie und Umweltkunde für die Sekundarstufe II (AHS-Oberstufe 2004) explizit die Stammzellforschung als Beispiel für einen Einblick in Forschungsschwerpunkte der modernen Biowissenschaften genannt wird, verzichtet die aktuelle kompetenzorientierte Lehrplanversion (2018) darauf. Auch neuere Lehrbücher nutzen die Stammzellforschung nur begrenzt um das naturwissenschaftliches Denken von Schülerinnen und Schülern und experimentelles Vorgehen zu fördern.br /Diese Diplomarbeit präsentiert ein modulares didaktisches Konzept, welches aktuellen biomedizinischen Fortschritt der Stammzellforschung exemplarisch aufgreift und mit forschungsnahem molekularbiologischem Lernen verbindet. Ziel des Workshops ist es moderne Methoden und Erkenntnisse der Stammzellforschung mithilfe interaktiver Umsetzung für SchülerInnen der Sekundarstufe II erfahrbar zu machen und vernetztes Denken durch Diskussion der ethischen Dimension biowissenschaftlicher Erkenntnisse zu stärken. SchülerInnen lernen naturwissenschaftliche Arbeitsweisen und Konzepte der Molekularbiologie kennen und erwerben grundlegende Forschungskompetenzen um als kritische DenkerInnen eine nachhaltige Auseinandersetzung mit dem Thema Wunderheiler Stammzelle als gesellschaftliche Dimension der Biowissenschaften anzustreben.br /Methodisch wird die Vermittlung von grundlegendem Wissen zur Stammzellforschung so aufbereitet, dass SchülerInnen selbständig exemplarisch in Versuchen ausprobieren, sich mit Berichten zu authentischen, aktuellen Themen aus der Stammzellwissenschaft und deren Herausforderungen und Chancen auseinandersetzen, und in angeleiteten Kleingruppendiskussion bioethisch Stellung beziehen können. Das didaktische Konzept soll die Begriffe Genomik, Stammzellbiologie und Regenerative Medizin für SchülerInnen greifbar machen und für öffentliche Auftritte des Instituts für Molekularbiologie genutzt werden können. Das didaktische Grundgerüst ist modular aufgebaut und kann individuell für einen Stand bei der Langen Nacht der Forschung, bei Aktionstagen der Jungen Uni oder in Form eines ganztägigen Workshops bei beispielsweise den UniStem Days genutzt werden.

e-Medien: https://ulb-dok.uibk.ac.at/9164576

Buchcover

Zeichenlehre für Landschaftsarchitekten Handbuch und Planungshilfe

Wilk, Sabrina

DOM publishers, 2023

ISBN 978-3-86922-890-7 | 2024-02-12 | 42 Architektur


Beschreibung: Trotz digitaler Einflüsse im Berufsalltag der Landschafts­architekten bleibt die Handzeichnung eine einzigartige, oft sogar künstlerische Ausdrucksform. Vom großmaßstäblichen Masterplan mit strategischen Ideen bis hin zu Entwurfskonzepten, wechselhaften Außenraumerlebnissen, dynamischer Vegetation und genauen baulichen Details – in kaum einem anderen Beruf müssen so viele unterschiedliche grafische Inhalte vermittelt werden. Dieses Handbuch ist als Einstieg für das Zeichnen und Darstellen im Landschaftsarchitekturstudium gedacht, aber auch als hilfreiches Nachschlagewerk für berufs­tätige Landschaftsarchitekten oder Gartengestalter. Es vermittelt auf einfache und verständliche Weise die Dar­stellungslehre, motiviert zum Zeichnen und ermutigt dabei, die eigene grafische Sprache zu entwickeln.

Bibliothekszentrum West: Freihand, 800/ZH 3550 W681(2) [verfügbar]

Buchcover

Zeit für Veränderung Berufung und Beruf im Einklang

Grün, Anselm

Vier-Türme-Verl, 2014

ISBN 978-3-89680-912-4 | 2024-02-01 | 05 Psychologie

Hauptbibliothek: Magazin HB, 742780 [verfügbar]

Buchcover

Zeitenwenden? der "neue" und der "alte" Kalte Krieg

Deppe, Frank,,

VSA Verlag, 2023

ISBN 978-3-96488-197-7 | 2024-02-08 | 09 Politik

Hauptbibliothek: Freihand, 600/MK 2000 D423 [verfügbar]

Buchcover

Zellstrukturdesign Organisationsdesign für Teamerfolg, Höchstleistung und Wertschöpfung im Flow

Pfläging, Niels

Verlag Franz Vahlen, 2024

ISBN 978-3-8006-7222-6 | 2024-02-19 | 13 Betriebswirtschaft

Fakultaetsbibliothek SoWi: Ebene 1: Bücher Selbstbedienung, 334-Pflä|b [verfügbar]

Buchcover

Zerfallserscheinungen der Demokratie

Calhoun, Craig J.

Suhrkamp, 2024

ISBN 978-3-518-30019-0 | 2024-02-23 | 09 Politik

Hauptbibliothek: Freihand, 600/ME 3000 C152 [reserviert]

Buchcover

Zerspiegelte Welten : Antisemitismus und Sprache aus jüdischer Perspektive

Bernstein, Julia

Beltz Juventa, 2023

ISBN 978-3-7799-6666-1 | 2024-02-26 | 11 Soziologie und Kulturwissenschaften

Hauptbibliothek: Freihand, 600/MS 3400 B531 [verfügbar]

Buchcover

Zethlingen - ein Brandgräberfeld der spätrömischen Kaiserzeit aus der Altmark die Ausgrabungen der Jahre 1989-2011

Leineweber, Rosemarie

Landesamt für Denkmalpflege und Archäologie Sachsen-Anhalt - Landesmuseum für Vorgeschichte, 2023

ISBN 978-3-948618-68-1 | 2024-02-12 | 55 Archäologie

Fachbibliothek Altertumswissenschaften: Freihand, 650/LE 7391 Z61 L5.2023 [verfügbar]

Buchcover

Zivilprozessordnung mit GVG und anderen Nebengesetzen

Anders, Monika

CHBeck, 2024

ISBN 978-3-406-80988-0 | 2024-02-08 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilgerichtliches Verfahren, [verfügbar]

Buchcover

Zivilprozessrecht Sammlung kommentierter Fälle

Roth, Marianne

MANZ'sche Verlags- und Universitätsbuchhandlung, 2024

ISBN 978-3-214-25446-9 | 2024-02-09 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilgerichtliches Verfahren, [entlehnt]

Buchcover

Zivilrecht

LexisNexis, 2023

ISBN 978-3-7007-8533-0 | 2024-02-12 | 08 Recht

Fakultaetsbibliothek SoWi: MCI-I, Universitätsstr. 15, 022-Ziv1 [entlehnt]

Buchcover

Zivilrechtswissenschaft Bausteine für eine Zivilrechtstheorie

Mohr Siebeck, 2024

ISBN 978-3-16-162771-2 | 2024-02-27 | 08 Recht

Fachbibliothek Recht: Bibliothek für Arbeits- und Sozialrecht, [verfügbar]

Buchcover

Zukunftsorientierte nachhaltige Stadtentwicklung eine transdisziplinäre Untersuchung am Beispiel eines innerstädtischen Quartiers

oekom verlag, 2023

ISBN 978-3-98726-077-3 | 2024-02-19 | 51 Raumplanung und Raumordnung

Zentraldepot: Externmagazin I, T236632 [verfügbar]

Buchcover

Zum wohnungseigentumsrechtlichen Änderungsrecht

Grundei, Gregor

facultas, 2023

ISBN 978-3-7089-2410-6 | 2024-02-14 | 08 Recht

Fachbibliothek Recht: Bibliothek für Zivilrecht, [verfügbar]

Buchcover

Zur Verwirklichung eines Vereinten Europas : Festschrift für Rudolf Streinz zum 70. Geburtstag

CHBeck, 2023

ISBN 978-3-406-80244-7 | 2024-02-02 | 08 Recht

Fachbibliothek Recht: Fachbibliothek Recht, 405 [verfügbar]

Buchcover

Zur Wissenschaft des Judentums aus der Gelehrtenkorrespondenz Markus Branns

Vandenhoeck & Ruprecht, 2023

ISBN 978-3-666-30243-5 | 2024-02-26 | 54 Geschichte


Beschreibung: Diese Edition bietet neue Einblicke in die Wissenschaft des Judentums und jüdische Fragen um 1900.

e-Medien: https://doi.org/10.13109/9783666302435

Buchcover

Zwischen Pädagogik und Heilkunst Kinderversorgung von der Renaissance bis zur Gegenwart

Zwischen Pädagogik und Heilkunst. Kinderversorgung von der Renaissance bis zur Gegenwart Wien 2021 Veranstaltung

Leipziger Universitätsverlag, 2022

ISBN 978-3-96023-483-8 | 2024-02-07 | 54 Geschichte

Hauptbibliothek: Freihand, 600/DS 3000 S328 [verfügbar]

Nach oben scrollen